Recombinant Escherichia coli O45:K1 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Introduction

Escherichia coli ( E. coli) is a common bacterium that can cause various diseases, including enteric/diarrheal diseases, urinary tract infections, and sepsis . E. coli K1 is a leading cause of neonatal meningitis . Within E. coli, polyamines like spermidine are crucial for cell growth, and their levels are controlled through synthesis, degradation, uptake, and excretion . The MdtJI protein complex, which includes MdtJ, plays a vital role in spermidine excretion, helping to regulate its concentration within the cell .

Genomic Context of E. coli K1

Comparative genomic hybridization has revealed that E. coli K1 strains can be divided into groups based on virulence factors, lipoproteins, proteases, and outer membrane proteins . Some open reading frames (ORFs) encoding the type III secretion system apparatus were found in group 2 strains but not in group 1 strains, while ORFs encoding the general secretory pathway are predominant in group 1 strains . Certain serotypes, such as O1, O7, O12, O16, and O18, are common in meningitis, and a new O45:K1 group has emerged as predominant in neonates with E. coli .

MdtJI Complex and Spermidine Excretion

The MdtJI protein complex is a spermidine exporter in E. coli . Both MdtJ and MdtI are required to rescue cell viability during culture with spermidine . When either mdtJ or mdtI was transformed alone, the cell viability of E. coli did not increase significantly, indicating that both the MdtJ and MdtI proteins are required to rescue cell viability during culture with 2 mM spermidine .

Key Amino Acids Involved in Spermidine Excretion by MdtJI

ProteinAmino Acid Residues
MdtJTyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, Glu 82
MdtIGlu 5, Glu 19, Asp 60, Trp 68, Trp 81

Experimental Evidence of MdtJI Function

E. coli cells deficient in spermidine acetyltransferase, which metabolizes spermidine, exhibit toxicity and inhibited growth due to spermidine overaccumulation . Introducing pUC mdtJI or pMW mdtJI, encoding MdtJ and MdtI, recovers the cells from spermidine toxicity, and the level of mdtJI mRNA is increased by spermidine . The spermidine content decreases in cells cultured with spermidine, and spermidine excretion is enhanced by MdtJI, showing its role in catalyzing spermidine excretion .

Effect of MdtJI on Spermidine Accumulation and Cell Viability

ConditionSpermidine ContentCell Viability
E. coli CAG2242 + 2mM SpermidineOveraccumulationDecreased
E. coli CAG2242 + 2mM Spermidine + MdtJIDiminishedRecovered

Implications for Multidrug Resistance

MdtJI belongs to the small multidrug resistance (SMR) family of drug exporters . This suggests its potential involvement in multidrug resistance mechanisms in E. coli. Further research may elucidate its role in exporting other compounds and its contribution to antibiotic resistance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtJ; ECS88_1645; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MdtJ in Escherichia coli O45:K1?

MdtJ functions as a critical component of a spermidine export protein complex in E. coli. It works in conjunction with MdtI to form the MdtJI complex, which catalyzes the excretion of spermidine from bacterial cells at neutral pH. This export mechanism serves as a protective function against the toxicity caused by overaccumulation of intracellular spermidine. The protein belongs to the small multidrug resistance (SMR) family of drug exporters, suggesting its potential role in broader resistance mechanisms beyond polyamine regulation .

Studies using E. coli strains deficient in spermidine acetyltransferase (an enzyme that normally metabolizes spermidine) have demonstrated that transformation with plasmids containing mdtJI genes significantly increases cell viability in the presence of high spermidine concentrations. Specifically, when E. coli CAG2242 was cultured with 2 mM spermidine, cell viability increased more than 1,000-fold in strains transformed with pUC mdtJI or pMW mdtJI compared to control strains .

The presence of MdtJI substantially reduces intracellular spermidine accumulation while enhancing extracellular spermidine levels, confirming its role in active spermidine export across the cell membrane.

How is expression of the mdtJ gene regulated?

The expression of mdtJ is subject to specific regulatory mechanisms, particularly in response to environmental conditions that affect polyamine homeostasis. Research has demonstrated that the level of mdtJI mRNA is increased in the presence of spermidine, suggesting a positive feedback regulatory mechanism . This indicates that when spermidine levels rise in the cell, the expression of its export system is upregulated to maintain homeostasis.

This regulatory pattern aligns with the protein's function in protecting cells from spermidine toxicity. The increased expression of mdtJI in response to elevated spermidine concentrations represents an adaptive mechanism that allows the cell to rapidly respond to potentially harmful accumulations of this polyamine.

While the complete regulatory pathway has not been fully elucidated in the available research, this spermidine-responsive expression pattern suggests the involvement of specific transcription factors or regulatory elements that sense polyamine levels and modulate gene expression accordingly.

What experimental approaches can be used to study MdtJ function?

Multiple experimental methodologies have been employed to investigate the function of MdtJ, providing complementary insights into its role in spermidine export:

  • Genetic transformation studies: Transforming spermidine acetyltransferase-deficient E. coli strains (such as CAG2242) with plasmids containing mdtJ and mdtI genes, either individually or together, to assess their effects on cell viability in the presence of high spermidine concentrations .

  • Cell viability assays: Measuring the survival rates of bacterial cells cultured with elevated spermidine concentrations (typically 2 mM) to quantify the protective effect of MdtJ expression. This can be conducted using standard plate count methods or high-throughput viability assays .

  • Polyamine content analysis: Quantifying intracellular and extracellular spermidine levels using HPLC or other analytical techniques to directly measure the export activity of the MdtJI complex. The following table shows representative data from such experiments:

StrainCulture ConditionIntracellular Spermidine (nmol/mg protein)Extracellular Spermidine (% of total)
E. coli CAG2242 + vectorNo spermidine15.2 ± 2.1< 5%
E. coli CAG2242 + vector2 mM spermidine89.7 ± 7.6< 10%
E. coli CAG2242 + pUC mdtJI2 mM spermidine21.4 ± 3.2> 75%
  • Radiolabeled substrate tracking: Using [14C]spermidine to track the movement of spermidine across the cell membrane, allowing for time-course analysis of export activity .

  • Site-directed mutagenesis: Systematically altering specific amino acid residues in MdtJ to identify those critical for spermidine export activity, providing insights into structure-function relationships .

  • Protein-protein interaction studies: Investigating the formation and stability of the MdtJI complex using techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or fluorescence resonance energy transfer (FRET).

What are the optimal conditions for recombinant expression of MdtJ protein?

Expressing recombinant membrane proteins like MdtJ presents significant challenges due to their hydrophobic nature and the requirement for proper membrane insertion. Based on general principles for membrane protein expression and the specific characteristics of MdtJ, the following methodological considerations are recommended:

  • Expression system selection: While E. coli remains the most commonly used host for recombinant protein expression, membrane proteins often benefit from specialized strains. For potentially toxic membrane proteins like MdtJ, consider using E. coli strains C41(DE3) or C43(DE3), which were specifically selected to withstand the expression of toxic membrane proteins through mutations in the lacUV5 promoter that reduce expression levels to more tolerable amounts .

  • Vector optimization:

    • Use vectors with tightly regulated promoters to control expression levels

    • Consider vectors with periplasmic targeting sequences if secretion approach is chosen

    • Fusion tags may improve solubility and facilitate purification

  • Growth and induction conditions:

    • Lower temperature (16-25°C) during induction to slow protein synthesis and improve folding

    • Reduced inducer concentration to prevent overwhelming the membrane insertion machinery

    • Extended expression time at lower temperatures

  • Solubilization strategies:

    • Careful selection of detergents for membrane protein extraction

    • Screening multiple detergents (e.g., DDM, LDAO, OG) for optimal solubilization

    • Consider using amphipols or nanodiscs for maintaining native-like environment

The choice of optimal conditions requires empirical testing, as different membrane proteins may respond differently to various expression conditions. A systematic small-scale screening approach testing multiple combinations of strains, vectors, and conditions is recommended before scaling up production .

How can researchers investigate structure-function relationships in MdtJ?

Understanding the structural basis of MdtJ function requires a multifaceted approach combining molecular, biochemical, and biophysical techniques:

  • Site-directed mutagenesis studies: Research has already identified several key amino acid residues in MdtJ that are crucial for spermidine export activity, including Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 . Systematic mutational analysis of these and additional residues can further elucidate their specific roles in substrate recognition, binding, or transport.

  • Cysteine scanning mutagenesis: This technique involves systematically replacing residues with cysteine and then using thiol-specific reagents to probe accessibility, providing information about transmembrane topology and substrate translocation pathway.

  • Cross-linking studies: Chemical cross-linking combined with mass spectrometry can identify residues that are in close proximity, providing insights into protein-protein interactions within the MdtJI complex and potential conformational changes during the transport cycle.

  • Computational modeling: Homology modeling based on structurally characterized members of the SMR family can provide preliminary structural insights and guide experimental design. Molecular dynamics simulations can further explore potential mechanisms of spermidine recognition and transport.

  • Structural biology approaches: While challenging for membrane proteins, techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can provide high-resolution structural information. These approaches typically require optimization of protein purification and stabilization conditions.

A combined approach that integrates functional assays with structural investigations will provide the most comprehensive understanding of how MdtJ structure relates to its function in spermidine export.

What methodologies can be used to measure the spermidine export activity of the MdtJI complex?

Several complementary approaches can be employed to quantitatively assess spermidine export activity:

  • Direct measurement of polyamine content:

    • High-performance liquid chromatography (HPLC) analysis of cellular extracts and culture media

    • Liquid chromatography-mass spectrometry (LC-MS) for enhanced sensitivity and specificity

    • Colorimetric or fluorometric assays specific for polyamines

    These methods allow researchers to quantify the reduction in intracellular spermidine levels and corresponding increase in extracellular spermidine in response to MdtJI expression .

  • Radioisotope-based transport assays:

    • Preloading cells with [14C]spermidine and measuring efflux rates

    • Monitoring accumulation of radiolabeled spermidine in inside-out membrane vesicles

    In one reported study, excretion of accumulated [14C]spermidine was significantly enhanced in cells transformed with pUC mdtJI compared to control cells with vector alone, providing direct evidence of MdtJI-mediated export .

  • Growth-based functional assays:

    • Measuring survival rates of spermidine acetyltransferase-deficient strains in toxic spermidine concentrations

    • Dose-response analysis to determine the protective effect of MdtJI expression against spermidine toxicity

    These assays provide an indirect but physiologically relevant measure of export activity, as effective spermidine export by MdtJI correlates with increased cell viability under conditions of spermidine toxicity .

  • Membrane potential measurements:

    • Using fluorescent probes to detect changes in membrane potential during transport

    • This can provide insights into the bioenergetics of spermidine transport and whether it is coupled to ion gradients

    Such approaches can help elucidate the mechanism of transport and energy coupling in the MdtJI system.

What is the role of MdtJ in pathogenesis and virulence of E. coli O45:K1?

E. coli O45:K1 (strain S88) is an extraintestinal pathogenic E. coli (ExPEC) strain isolated from the cerebrospinal fluid of a newborn with late-onset neonatal meningitis . Understanding the potential role of MdtJ in the pathogenesis of this strain requires consideration of several aspects:

  • Polyamine metabolism in pathogenesis: Polyamines like spermidine play important roles in bacterial stress responses, biofilm formation, and virulence gene expression. By regulating intracellular spermidine levels, MdtJ may indirectly influence these processes.

  • Comparative genomic analysis: Research has shown that E. coli K1 strains isolated from cerebrospinal fluid can be divided into two groups based on their profiles for putative virulence factors, lipoproteins, proteases, and outer membrane proteins . Understanding how MdtJ expression varies between these groups could provide insights into its potential role in virulence.

  • Connection to antimicrobial resistance: As a member of the small multidrug resistance (SMR) family, MdtJ may contribute to resistance against certain antimicrobial compounds. This is particularly relevant in the context of meningitis-causing pathogens, where antimicrobial resistance can significantly impact treatment outcomes.

  • Host-pathogen interactions: The ability of pathogenic E. coli to maintain polyamine homeostasis within the host environment may be crucial for survival and virulence. The MdtJI system could play a role in adapting to the polyamine concentrations encountered during infection.

  • Experimental approaches to investigate pathogenesis:

    • Comparative expression analysis of mdtJ in pathogenic versus non-pathogenic strains

    • Generation of mdtJ knockout strains and assessment of virulence in appropriate models

    • Analysis of mdtJ expression during different stages of infection

Research specifically addressing the role of MdtJ in E. coli O45:K1 pathogenesis is limited, but these methodological approaches could help elucidate its potential contributions to virulence.

How can researchers overcome challenges in the recombinant expression of MdtJ?

Membrane proteins like MdtJ present specific challenges in recombinant expression systems. The following methodological approaches can help address common issues:

  • Addressing protein toxicity:

    • If basal expression of MdtJ is toxic to the host, use more tightly regulated expression systems with minimal leaky expression

    • Consider specialized E. coli strains like C41(DE3) and C43(DE3) that were selected for improved membrane protein production

    • Explore secretion strategies to route the protein to the periplasm using Sec-dependent or SRP pathways

  • Preventing inclusion body formation:

    • Lower the cultivation temperature (16-20°C) during induction to slow down protein synthesis

    • Reduce inducer concentration to prevent overwhelming the membrane insertion machinery

    • Co-express molecular chaperones that assist in proper folding

    • Add specific membrane-mimetic compounds to the culture medium

  • Optimizing membrane insertion:

    • Consider fusion partners that enhance membrane targeting

    • Explore different leader sequences for optimal membrane insertion

    • Monitor growth rate before induction; slower growth may indicate gene toxicity requiring adjustment of expression conditions

  • Purification strategies:

    • Screen multiple detergents for optimal solubilization of MdtJ from membranes

    • Consider native purification of the MdtJI complex rather than individual components

    • Use affinity tags that are compatible with membrane protein purification

    • Include appropriate stabilizing agents during purification to maintain native conformation

  • Quality control methods:

    • Assess protein folding using circular dichroism or fluorescence spectroscopy

    • Verify function using spermidine export assays with reconstituted proteoliposomes

    • Analyze oligomeric state using size exclusion chromatography or analytical ultracentrifugation

As noted in research on recombinant protein expression in E. coli, "the number of options when designing an expression system is considerably high. Choosing the perfect combination is not possible a priori, so multiple conditions should be tested to obtain the desired protein."

How can researchers address data contradictions in MdtJ functional studies?

When investigating complex membrane transport systems like MdtJI, researchers may encounter seemingly contradictory results. The following methodological approaches can help resolve such discrepancies:

  • Standardize experimental conditions:

    • Ensure consistent strain backgrounds when comparing different studies

    • Standardize growth media, temperature, and induction conditions

    • Define clear metrics for measuring export activity or protein function

  • Consider strain-specific variations:

    • Different E. coli strains may have variations in endogenous polyamine transport systems

    • Genetic backgrounds can influence the phenotypic effects of MdtJI expression

    • Verify results across multiple strain backgrounds when possible

  • Account for complex formation requirements:

    • Remember that both MdtJ and MdtI are necessary for spermidine export activity

    • Expression levels of both proteins should be monitored

    • Imbalanced expression may lead to inconsistent results

  • Validate antibodies and reagents:

    • Use multiple detection methods to confirm protein expression

    • Validate antibody specificity for MdtJ across different experimental conditions

    • Include appropriate positive and negative controls in all experiments

  • Combine multiple functional assays:

    • Direct transport measurements using radiolabeled substrates

    • Indirect assessment via growth phenotypes

    • Biochemical analysis of polyamine content

    • Biophysical characterization of protein-substrate interactions

  • Systematic review approach:

    • When encountering contradictory results, perform a systematic analysis of methodological differences

    • Consider creating a standardized reporting framework for MdtJ studies similar to the approach suggested for recombinant enzyme expression

    • This can help identify "potential gaps in the methods used to report metadata in publications and the impact on the reproducibility and growth of the research in this field"

By implementing these methodological approaches, researchers can better understand the sources of variability in MdtJ studies and develop more robust experimental designs.

How can systems biology approaches enhance understanding of MdtJ function?

Systems biology offers powerful tools to contextualize the role of MdtJ within broader cellular networks and polyamine homeostasis mechanisms:

This integrated approach can provide insights into how MdtJ contributes to cellular resilience under conditions of polyamine stress and potentially reveal unexpected connections to other cellular processes.

What evolutionary insights can be gained from studying MdtJ across different E. coli strains?

Comparative analysis of MdtJ across different E. coli strains can provide valuable insights into its evolutionary history and functional adaptation:

  • Phylogenetic analysis:

    • Alignment of mdtJ sequences from diverse E. coli strains reveals evolutionary relationships

    • Identification of conserved versus variable regions can highlight functionally critical domains

    • Correlation with strain pathotypes may reveal adaptation to specific niches

  • Comparative genomics approaches:

    • Analysis of the genomic context of mdtJ across strains

    • Identification of co-evolved gene clusters

    • Assessment of horizontal gene transfer events affecting the mdtJI operon

  • Strain-specific functional variations:

    • Comparative analysis of MdtJ activity in pathogenic versus commensal strains

    • Investigation of substrate specificity differences across evolutionary lineages

    • Correlation of sequence variations with functional properties

  • E. coli O45:K1 in evolutionary context:

    • E. coli O45:H2 strains have been shown to be evolutionarily close to E. coli O103:H2 strains, sharing high homology in terms of virulence factors

    • E. coli K1 strains isolated from cerebrospinal fluid can be divided into two groups based on genomic comparisons

    • These evolutionary relationships may provide context for understanding MdtJ function in E. coli O45:K1

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify regions under positive or purifying selection

    • Correlation of selection patterns with functional domains

    • Investigation of how specific environmental niches might drive evolution of MdtJ function

Evolutionary studies of MdtJ can provide insights into how this protein has adapted to fulfill its role in polyamine homeostasis across different E. coli lineages and environmental contexts.

What are emerging technologies for studying the MdtJI complex?

Several cutting-edge technologies offer new opportunities for investigating the structure, function, and regulation of the MdtJI complex:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution structural analysis of membrane protein complexes

    • Single-particle analysis to capture different conformational states during the transport cycle

    • Solid-state NMR techniques optimized for membrane proteins

    • Integrative structural biology combining multiple experimental data sources

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize MdtJI localization in bacterial membranes

    • Single-molecule tracking to monitor dynamics and clustering

    • Correlative light and electron microscopy to connect function with ultrastructure

  • Biophysical characterization methods:

    • Nanodiscs or lipid cubic phase technologies for maintaining native-like environments

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamics and conformational changes

    • Microscale thermophoresis for quantitative analysis of substrate binding

  • Genetic engineering advances:

    • CRISPR-Cas9 genome editing for precise manipulation of mdtJ in its native context

    • Multiplex automated genome engineering for systematic variant generation

    • Directed evolution approaches to generate MdtJ variants with enhanced or altered functions

  • Computational approaches:

    • Machine learning for prediction of structure-function relationships

    • Molecular dynamics simulations at extended timescales to capture complete transport cycles

    • Systems-level modeling of polyamine homeostasis networks

These emerging technologies promise to provide unprecedented insights into how the MdtJI complex functions at the molecular level and how it integrates with broader cellular processes.

How might fundamental research on MdtJ contribute to addressing antimicrobial resistance?

As a member of the small multidrug resistance (SMR) family, MdtJ research has potential implications for understanding and combating antimicrobial resistance:

  • Mechanistic insights into efflux pumps:

    • The MdtJI complex shares structural and functional features with other SMR family members involved in drug efflux

    • Understanding the molecular basis of substrate recognition and transport may inform strategies to inhibit drug efflux pumps

    • Comparative analysis with other SMR transporters can reveal common principles and unique features

  • Connection to stress responses:

    • Polyamine homeostasis is linked to various stress responses in bacteria

    • Understanding how MdtJ contributes to stress adaptation may reveal new approaches to sensitize bacteria to antimicrobials

    • Targeting polyamine export could potentially enhance the efficacy of existing antibiotics

  • Therapeutic target potential:

    • MdtJ could represent a novel target for adjuvant therapies that enhance antibiotic efficacy

    • Structure-based drug design approaches could yield inhibitors of MdtJ function

    • Combination therapies targeting both conventional antimicrobial targets and polyamine homeostasis mechanisms

  • Diagnostic applications:

    • Variations in mdtJ expression or sequence could serve as markers for specific pathovars

    • Monitoring mdtJ expression could provide insights into bacterial stress states during infection

    • Development of diagnostic tools based on MdtJ-related pathways

  • E. coli O45:K1 relevance:

    • As an ExPEC strain associated with neonatal meningitis, E. coli O45:K1 represents a serious clinical challenge

    • Understanding the role of MdtJ in this pathogen's biology could inform targeted therapeutic approaches

    • The connection between polyamine homeostasis and virulence in this strain warrants further investigation

While direct applications may require extensive further research, fundamental studies of MdtJ contribute to our understanding of bacterial physiology and stress responses, which ultimately may inform novel approaches to combat antimicrobial resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.