Recombinant Escherichia coli O45:K1 Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Features of Recombinant uspB

PropertyDetails
SourceEscherichia coli O45:K1 (strain S88/ExPEC)
Expression systemIn vitro E. coli expression system
Molecular weightPredicted ~16–18 kDa (exact mass depends on post-translational modifications)
Functional roleStress adaptation, biofilm formation, virulence regulation
Associated pathwaysRcs phosphorelay system, purine biosynthesis

Role in Bacterial Stress Response and Virulence

uspB is critical for surviving hostile host environments:

  • Biofilm formation: Curli amyloid fibers, whose production is regulated by uspB, enhance biofilm formation in uropathogenic E. coli (UPEC) strains like O45:K1:H7. Biofilms confer resistance to cationic antimicrobial peptides (e.g., LL-37) and promote bladder colonization .

  • Stress adaptation: uspB interacts with the Rcs phosphorelay system and purine biosynthesis pathways to mitigate nutrient deprivation and oxidative stress .

  • Host colonization: Deletion of uspB in UPEC O45:K1:H7 attenuates bladder colonization in murine models, underscoring its role in pathogenesis .

Genomic and Epidemiological Context

E. coli O45:K1:H7 strains carrying uspB are part of the high-risk ST95 clonal group, which is implicated in:

  • Human infections: Neonatal meningitis, UTIs, and bacteremia .

  • Zoonotic transmission: Poultry serves as a reservoir for O45:K1:H7 strains, highlighting cross-species transmission risks .

Table 2: Virulence Traits of uspB-Positive E. coli O45:K1

TraitMechanismClinical Impact
Curli productionEnhances biofilm formation and immune evasionChronic UTIs, antibiotic resistance
K1 capsuleProtects against serum killingNeonatal meningitis
Iron acquisitionUtilizes siderophores (e.g., enterobactin)Systemic infection persistence

Recombinant uspB in Research Applications

  • Pathogenesis studies: Used to dissect mechanisms of stress response and host-pathogen interactions .

  • Therapeutic target: Screening inhibitors of uspB could disrupt biofilm formation or virulence .

  • Diagnostic marker: Detected in ST95 strains causing severe infections, aiding epidemiological tracking .

Key Research Findings

  1. Genetic screen identification: A forward genetic screen identified uspB as essential for curli synthesis in UPEC O45:K1:H7. Mutants lacking uspB failed to express CsgA (curli major subunit) and showed reduced virulence .

  2. Cross-host pathogenicity: O45:K1:H7 strains from poultry and humans share ≥85% genomic identity, suggesting a common evolutionary origin .

  3. Temperature-dependent expression: uspB-mediated curli production occurs at human physiological temperatures (37°C), aligning with host infection conditions .

Future Directions

  • Structural studies: Elucidate the 3D structure of uspB to design targeted inhibitors.

  • Vaccine development: Explore uspB as a candidate antigen for vaccines against ExPEC infections.

  • One Health surveillance: Monitor uspB-positive strains in animal reservoirs to preempt zoonotic outbreaks .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uspB; ECS88_3898; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Universal Stress Protein (USP) family and how does uspB fit within this classification?

The Universal Stress Protein (UspA) superfamily encompasses a conserved group of proteins found in bacteria, archaea, and eukaryotes. E. coli harbors six well-characterized usp genes: uspA, uspC, uspD, uspE, uspF, and uspG, along with uspB. These genes are expressed in response to various environmental stressors, such as nutrient limitation, heat, oxidative agents, metals, and antibiotics . UspB belongs to this superfamily but has distinct structural and functional characteristics. Unlike the better-studied USPs, uspB requires specific experimental approaches for characterization due to its unique properties among the USP family.

How are Universal Stress Proteins structurally organized in bacterial systems?

USPs in bacterial systems typically exist in three structural configurations:

  • Small USP proteins (approximately 14-15 kDa) containing a single USP domain

  • Larger USPs (approximately 30 kDa) consisting of two USP domains in tandem

  • Complex USPs where the USP domain exists alongside other functional domains

Based on structural analysis and amino acid sequences, E. coli USPs are categorized into four distinct classes:

  • Class I: UspA, UspC, and UspD

  • Class II: UspF and UspG

  • Class III and IV: The two domains of UspE separate into these classes

While not explicitly classified in the available research, uspB likely belongs to one of these structural groups, requiring additional structural characterization to confirm its precise classification.

What are the optimal conditions for recombinant expression of uspB in E. coli?

For optimal recombinant expression of uspB in E. coli, consider implementing the following protocol based on successful approaches for similar proteins:

  • Vector selection: Use a pET-based expression vector with an N-terminal His-tag for efficient purification.

  • Expression strain: BL21(DE3) or its derivatives are recommended for maximum yield.

  • Culture conditions:

    • Grow cultures at 37°C until reaching OD600 of 0.6-0.8

    • Induce with 0.5 mM IPTG and reduce temperature to 18-25°C for 16-18 hours of expression

    • Alternatively, use autoinduction media at lower temperatures (16-25°C) for 24-48 hours

  • Media optimization: Autoinduction media has been shown to enhance soluble protein expression compared to conventional IPTG induction for stress-related proteins .

  • Temperature management: Lower temperatures (18-25°C) during induction significantly increase soluble protein yields by reducing inclusion body formation, especially critical for stress-related proteins .

What purification strategies yield the highest purity and biological activity of recombinant uspB?

Based on successful approaches with similar proteins, the following purification strategy is recommended:

  • Cell lysis: Sonication or high-pressure homogenization in a buffer containing 50 mM Tris-HCl pH 8.0, 500 mM NaCl, 20 mM imidazole, and 10% glycerol.

  • Initial purification: Ni-NTA affinity chromatography with:

    • Binding: 50 mM Tris-HCl pH 8.0, 500 mM NaCl, 20 mM imidazole

    • Washing: Same buffer with 50 mM imidazole

    • Elution: Same buffer with 250-500 mM imidazole gradient

  • Tag removal: If a cleavable tag was incorporated, use TEV or thrombin protease (depending on the cleavage site engineered) to remove the His-tag .

  • Secondary purification: Size-exclusion chromatography using Superdex 75 or 200 in 20 mM Tris-HCl pH 7.5, 150 mM NaCl to achieve >85% purity .

  • Quality control: Verify protein purity by SDS-PAGE and confirm proper folding using circular dichroism spectroscopy.

To maximize biological activity, add 5-50% glycerol to the final purified protein and store at -80°C in small aliquots to avoid repeated freeze-thaw cycles .

How can experimental design approaches improve uspB production yields?

Implementing a systematic experimental design approach can significantly enhance uspB expression yields. Consider the following strategy:

  • Factorial design: Establish a multifactorial experimental matrix examining:

    • Induction temperature (15°C, 25°C, 37°C)

    • Inducer concentration (0.1 mM, 0.5 mM, 1.0 mM IPTG)

    • Media composition (LB, TB, autoinduction)

    • Harvest time (4h, 8h, 16h, 24h post-induction)

  • Response surface methodology (RSM): After identifying significant factors, use RSM to find optimal parameter combinations.

  • Signal peptide screening: If periplasmic expression is desired, test multiple signal peptides (e.g., DsbA, Hbp, OmpA, PhoA) to identify the optimal targeting pathway .

  • Tunable expression systems: Consider using the rhamnose promoter system in a strain background with the rha operon deleted, which allows precise tuning of expression levels to match the cell's secretory capacity .

This systematic approach has enabled researchers to achieve yields of 250 mg/L for other recombinant proteins in E. coli with 75% homogeneity , providing a benchmark for uspB production optimization.

What functional assays are appropriate for determining the biological activity of purified recombinant uspB?

Based on functional studies of other USP family members, the following assays are recommended for characterizing uspB activity:

  • Oxidative stress resistance assays:

    • Challenge E. coli cells expressing uspB with phenazine methosulfate (PMS) and measure survival rates

    • Test resistance to tert-butyl hydroperoxide (t-BOOH) at concentrations between 0.5-1%

  • Iron homeostasis evaluation:

    • Assess sensitivity to streptonigrin, which is potentiated by free intracellular iron

    • Compare wild-type and uspB mutant strains to determine uspB's role in iron regulation

  • Cell aggregation and adhesion studies:

    • Measure cell-to-cell aggregation in liquid cultures

    • Quantify fimbria-mediated adhesion using yeast agglutination assays

  • Motility assessment:

    • Perform swimming motility assays on semi-solid agar

    • Use electron microscopy to examine flagellar structures

How does uspB differ functionally from other universal stress proteins in E. coli?

While specific functional data on uspB is limited in the provided sources, a comparative analysis with other USP family members reveals potential functional distinctions:

USP ProteinOxidative Stress ResponseIron MetabolismMotilityAdhesionPrimary Function
UspAStrong role in defense against superoxideNo significant roleNo significant roleNo significant roleSurvival during growth arrest
UspDStrong role in defense against superoxideImportant in controlling intracellular ironNo significant roleNo significant roleOxidative stress defense
UspCNo role in stress resistanceNo role in iron metabolismEssential for motilityPromotes motility over adhesionFlagella development
UspECrucial for high concentrations of oxidantsNo significant roleEssential for motilityPromotes motility over adhesionFlagella development
UspFMinor role in oxidative stress resistanceMinor roleNo role in motilityPromotes adhesion over motilityCell adhesion
UspGMinor role in oxidative stress resistanceMinor roleNo role in motilityPromotes adhesion over motilityCell adhesion
UspB????Requires further characterization

This table highlights the need for specific functional studies on uspB to determine its role within the USP family network .

What role does uspB play in bacterial pathogenesis and antimicrobial resistance?

Current research suggests that USPs, including potentially uspB, play crucial roles in bacterial pathogenesis and antimicrobial resistance through several mechanisms:

  • Stress-mediated resistance: USP expression is triggered by various stressors, including antibiotics, creating general resistance mechanisms .

  • Phagocytosis resistance: USPs have been implicated in helping bacteria resist macrophage phagocytosis, a critical virulence factor .

  • Biofilm formation: Through their effects on adhesion, USPs contribute to biofilm formation, which enhances antimicrobial resistance.

  • Metabolic adaptation: USPs help bacteria adapt metabolically during stress conditions, potentially enhancing survival during antibiotic exposure.

Research into uspB specifically may reveal unique contributions to these pathogenesis and resistance mechanisms, particularly in extraintestinal pathogenic E. coli (ExPEC) strains like O45:K1, which are associated with serious infections including neonatal meningitis and sepsis .

How can site-directed mutagenesis be used to identify critical functional residues in uspB?

To identify critical functional residues in uspB, implement the following site-directed mutagenesis approach:

  • Sequence alignment and structural prediction:

    • Perform multiple sequence alignment with other USP family members

    • Use structural prediction tools to identify conserved domains and potential active sites

    • Focus on residues conserved across USPs with similar functions

  • Strategic mutation design:

    • Alanine scanning of conserved residues

    • Conservative and non-conservative substitutions at potential functional sites

    • Creation of chimeric proteins between uspB and other USPs to identify domain-specific functions

  • Functional assessment of mutants:

    • Express wild-type and mutant variants under identical conditions

    • Conduct comparative functional assays (oxidative stress response, adhesion, etc.)

    • Determine protein stability and structural changes using circular dichroism and thermal shift assays

This approach has successfully identified functional residues in other USPs and can elucidate the structure-function relationship of uspB .

What are the challenges in crystallizing uspB for structural studies, and how can they be overcome?

Crystallizing uspB for structural studies presents several challenges that can be addressed through the following strategies:

  • Protein heterogeneity challenges:

    • Implement on-column refolding techniques during purification

    • Use size-exclusion chromatography as a final polishing step

    • Apply dynamic light scattering to verify monodispersity

  • Construct optimization:

    • Create truncated constructs to remove potentially disordered regions

    • Design fusion constructs with crystallization chaperones (T4 lysozyme, MBP, etc.)

    • Test both N- and C-terminal His-tags with various linker lengths

  • Crystallization condition screening:

    • Implement sparse matrix screens at multiple temperatures (4°C, 18°C)

    • Test both vapor diffusion and under-oil crystallization techniques

    • Add small molecules that may stabilize protein conformation

  • Alternative approaches if crystallization fails:

    • Nuclear Magnetic Resonance (NMR) for solution structure determination

    • Cryo-electron microscopy for structural analysis

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

These approaches have successfully yielded structures for other USP family members and could be adapted for uspB .

How can transcriptomics and proteomics approaches be integrated to understand the uspB regulon?

To comprehensively understand the uspB regulon, integrate transcriptomics and proteomics using the following approach:

  • Experimental design:

    • Generate uspB knockout, wild-type, and uspB-overexpressing strains

    • Subject strains to relevant stress conditions (oxidative stress, nutrient limitation)

    • Collect samples at multiple time points to capture dynamic responses

  • Multi-omics data collection:

    • RNA-seq to identify differentially expressed genes

    • Ribosome profiling to assess translational efficiency

    • Shotgun proteomics to quantify protein abundance changes

    • Phosphoproteomics to identify post-translational modifications

  • Integrated data analysis:

    • Correlate transcript and protein level changes

    • Identify potential direct targets through motif analysis

    • Construct gene regulatory networks using algorithms like WGCNA or ARACNE

    • Validate key interactions through ChIP-seq or similar techniques

  • Functional validation:

    • CRISPR interference to validate regulatory relationships

    • Promoter-reporter fusions to confirm direct regulation

    • Epistasis analysis between uspB and identified targets

This integrated approach will reveal the comprehensive regulatory network of uspB and its role in stress response coordination .

How can CRISPR-Cas9 technology be utilized to study uspB function in various E. coli strains?

CRISPR-Cas9 technology offers powerful approaches for studying uspB function:

  • Precise genome editing:

    • Generate clean uspB knockout strains without polar effects

    • Create point mutations to study specific residues in the native genetic context

    • Insert reporter tags (fluorescent proteins, epitope tags) at the native locus

  • Regulatory studies using CRISPR interference (CRISPRi):

    • Design sgRNAs targeting the uspB promoter or coding region

    • Create tunable repression using dCas9 to generate a gradient of uspB expression

    • Implement multiplexed CRISPRi to simultaneously modulate uspB and related genes

  • High-throughput phenotypic screening:

    • Create CRISPR-based strain libraries with variations in uspB and related genes

    • Screen for phenotypes under various stress conditions

    • Implement Perturb-seq approaches to link genotype to transcriptional phenotypes

  • In vivo dynamics:

    • Use CRISPR-based imaging techniques to visualize uspB localization during stress

    • Create biosensors using dCas9-based systems to monitor uspB expression in real-time

This technology allows for unprecedented precision in studying uspB function across different genetic backgrounds and environmental conditions .

What are the most promising directions for developing antimicrobial strategies targeting the USP system?

Based on the emerging understanding of USP functions, several promising antimicrobial strategies targeting USPs, including uspB, can be considered:

  • Direct inhibition approaches:

    • Structure-based design of small molecule inhibitors targeting conserved USP domains

    • Peptide inhibitors designed to disrupt USP protein-protein interactions

    • Allosteric modulators that prevent USP activation during stress

  • Potentiation strategies:

    • USP inhibitors as adjuvants to enhance conventional antibiotic efficacy

    • Compounds that interfere with stress-triggered USP upregulation

    • Targeting multiple USPs simultaneously to overcome functional redundancy

  • Virulence attenuation:

    • Inhibitors targeting USP-mediated adhesion to prevent colonization

    • Compounds disrupting USP-dependent biofilm formation

    • Modulators enhancing susceptibility to immune clearance

  • Resistance prevention:

    • Cycling between USP-targeting compounds and conventional antibiotics

    • Combination therapies targeting multiple bacterial stress response systems

    • Pre-emptive targeting of USPs to prevent stress-induced resistance development

These approaches represent novel antibiotic development strategies that could address the growing challenge of antimicrobial resistance by targeting bacterial stress response systems rather than essential functions .

How might synthetic biology approaches utilize engineered uspB variants for biotechnological applications?

Synthetic biology offers innovative ways to harness engineered uspB variants for biotechnological applications:

  • Biosensing applications:

    • Engineer uspB-based whole-cell biosensors for detecting environmental stressors

    • Develop reporter systems using uspB promoters to monitor cellular stress in industrial bioprocesses

    • Create tunable genetic circuits with uspB as a stress-responsive element

  • Improved recombinant protein production:

    • Develop engineered E. coli strains with modified uspB expression for enhanced stress tolerance during protein production

    • Create feedback loops linking uspB activation to reduced recombinant protein expression rate, preventing cellular overload

    • Incorporate uspB-based stress detection systems into bioreactor control algorithms

  • Bioremediation applications:

    • Engineer bacteria with enhanced uspB functionality for improved survival in contaminated environments

    • Develop strains with modified uspB systems optimized for specific pollutants

    • Create consortia with complementary uspB variant functions for complex bioremediation challenges

  • Therapeutic probiotics:

    • Engineer probiotic strains with modified uspB to enhance survival in the gastrointestinal tract

    • Develop strains with uspB variants optimized for specific inflammatory conditions

    • Create targeted delivery systems using uspB-based stress sensing for site-specific therapeutic release

These applications leverage the natural stress-responsive properties of uspB within engineered biological systems to address various biotechnological challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.