Recombinant Escherichia coli O45:K1 UPF0208 membrane protein YfbV (yfbV)

What is the Escherichia coli O45:K1 UPF0208 membrane protein YfbV?

YfbV is a membrane protein found in Escherichia coli O45:K1, a pathogenic strain associated with extraintestinal pathogenic E. coli (ExPEC) infections. The protein belongs to the UPF0208 family, where "UPF" designates "Uncharacterized Protein Family," indicating that its precise biological function remains incompletely understood. YfbV is classified as a membrane protein based on its sequence characteristics and predicted structure. The full protein consists of 151 amino acids and has a UniProt accession number of B7MG59 for the strain S88/ExPEC .

How should researchers approach subcellular localization studies for YfbV?

While YfbV is classified as a membrane protein, determining its precise subcellular localization requires experimental confirmation. Multiple complementary approaches are recommended:

• Subcellular fractionation: Separate inner membrane, outer membrane, and periplasmic fractions using established protocols, followed by immunoblotting with YfbV-specific antibodies.

• Protein correlation profiling (PCP): This approach combines quantitative proteomics with gradient fractionation to determine the localization pattern of membrane proteins, as demonstrated for other E. coli membrane proteins .

• Fluorescent protein fusions: Create C-terminal or N-terminal fusions with fluorescent proteins like GFP, ensuring the fusion does not disrupt membrane targeting.

• Protease accessibility assays: Determine the topology of YfbV by exposing intact cells, spheroplasts, or membrane vesicles to proteases and analyzing the protected fragments.

• Immunogold electron microscopy: For high-resolution localization, use gold-labeled antibodies against YfbV in conjunction with electron microscopy.

Combining these approaches provides the most reliable determination of YfbV's localization within the bacterial cell envelope.

Which expression systems are most effective for recombinant YfbV production?

For optimal expression of membrane proteins like YfbV, several key factors should be considered based on experimental evidence:

Studies have demonstrated that the highest expression yields for membrane proteins were achieved with vectors containing the p15A origin (low copy number) combined with the Ptrc promoter when using glycerol as a carbon source .

How do different E. coli strains affect YfbV expression outcomes?

The choice of E. coli strain significantly impacts membrane protein expression success. Based on research findings, the following strains merit consideration:

• BL21(DE3): The standard workhorse for protein expression that lacks lon and ompT proteases, reducing heterologous protein degradation.

• BL21(DE3) ΔackA: This strain shows higher recombinant protein production compared to wild-type BL21 due to reduced acetate accumulation during fermentation . Experimental data demonstrates consistent improvement in protein expression, particularly when growing on glycerol rather than glucose.

• C41(DE3) and C43(DE3): These derivatives of BL21(DE3) contain adaptations that make them more tolerant to membrane protein overexpression, reducing toxicity and increasing yields.

• Lemo21(DE3): Allows fine-tuning of expression by modulating T7 RNA polymerase activity through rhamnose-inducible lysozyme expression, beneficial for potentially toxic membrane proteins.

For initial YfbV expression trials, comparison between BL21(DE3) and BL21(DE3) ΔackA strains using both glucose and glycerol as carbon sources would establish baseline performance before moving to more specialized strains if necessary .

What are the specific challenges in expressing membrane proteins like YfbV in E. coli?

Membrane protein expression presents unique challenges that require specialized strategies:

• Insertion machinery limitations: The Sec translocon and YidC insertase can become saturated during overexpression, leading to protein misfolding and aggregation.

• Inclusion body formation: The hydrophobic nature of membrane proteins often leads to aggregation when expression exceeds the capacity for proper membrane insertion.

• Toxicity to host cells: Membrane protein overexpression can disrupt membrane integrity and cellular homeostasis.

• Proper folding maintenance: Achieving native conformation outside the natural lipid environment is challenging.

• Post-translational modification requirements: If YfbV requires specific modifications, these may not occur correctly in heterologous systems.

To address these challenges, researchers should:

• Use weaker promoters and lower copy number vectors to reduce expression rates

• Lower growth temperature (20-25°C) to slow protein synthesis and facilitate proper folding

• Consider co-expression of chaperones or components of the membrane protein insertion machinery

• Employ specialized strains like C41/C43 designed for membrane protein expression

• Optimize induction conditions through systematic testing of inducer concentrations and timing

How does copy number of expression vectors influence YfbV production?

Vector copy number significantly impacts membrane protein production success. Experimental data reveals clear differences between high and low copy vectors:

Research specifically demonstrated that for model protein expression, the highest yields were achieved with p15A-based vectors combined with moderate-strength promoters like Ptrc when growing cells on glycerol . The same study showed that combining high copy number vectors with strong promoters resulted in decreased protein production due to metabolic burden.

For membrane proteins like YfbV, this effect would be even more pronounced due to the additional challenges of membrane protein biogenesis. Therefore, low to medium copy number vectors are strongly recommended for YfbV expression .

What purification strategies are most effective for YfbV membrane protein?

Purifying membrane proteins like YfbV requires specialized approaches to maintain structural integrity. A recommended workflow includes:

• Membrane preparation:

  • Cell lysis via French press (8000 psi, three passes) in buffer containing protease inhibitors like PMSF

  • Isolation of membrane fraction through ultracentrifugation (100,000 × g)

  • Resuspension in suitable buffer (e.g., TSG buffer: 50 mM Tris HCl pH 8, 50 mM NaCl, 10% glycerol)

• Solubilization optimization:

  • Initial screening with mild detergents like DDM (0.5-1%)

  • Incubation on ice for 15-30 minutes followed by ultracentrifugation to remove insoluble material

  • Optimization of detergent type, concentration, and solubilization conditions

• Affinity purification:

  • His-tag purification using Ni-NTA resin

  • Maintenance of detergent in all buffers

  • Careful optimization of imidazole concentrations for washing and elution

• Advanced approaches:

  • Peptidisc method: This innovative approach uses amphipathic peptides to stabilize membrane proteins without detergents

  • The method involves mixing detergent-solubilized proteins with peptidisc peptides followed by detergent removal

  • This approach better preserves native protein-protein interactions compared to detergent-based methods

• Final polishing:

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Analysis of oligomeric state and complex formation

The peptidisc approach described in the research is particularly valuable as it can maintain membrane proteins in a native-like environment and preserve interactions that would be disrupted in conventional purification methods .

How can researchers assess the proper folding of recombinant YfbV?

Ensuring proper folding of membrane proteins is critical for meaningful structural and functional studies. Multiple complementary approaches should be employed:

For YfbV specifically, in the absence of a well-defined function, structural characterization combined with protein-protein interaction studies would provide the best indication of proper folding. The peptidisc approach mentioned in the research could be particularly valuable, as it maintains membrane proteins in a more native-like environment than detergent micelles .

What analytical techniques best characterize YfbV interactions?

Based on current research methodologies, several powerful techniques can effectively characterize membrane protein interactions:

• Protein-Correlation-Profiling (PCP) with SILAC labeling:

  • Involves stable isotope labeling with heavy lysine (Lys4, 2H4-lysine)

  • Enables fractionation of membrane complexes without detergent solubilization

  • Preserves native interactions while providing quantitative comparison

  • Successfully identified over 4900 binary interactions in the E. coli membrane proteome

• Affinity Purification-Mass Spectrometry (AP-MS):

  • Employ His-tagged YfbV expressed in SILAC labeling conditions

  • Brief solubilization with detergent followed by immediate trapping in peptidisc

  • Isolation via Ni-NTA and identification of co-purified proteins by LC-MS/MS

  • Compare with control purifications to identify specific interactors

• Crosslinking Mass Spectrometry:

  • Chemical crosslinking of proximal proteins in native membranes

  • Identification of crosslinked peptides provides spatial information about interaction interfaces

• FRET-based interaction studies:

  • Fluorescent protein fusions to study proximity in living cells

  • Provides dynamic information about interactions under various conditions

The peptidisc-based approach is particularly valuable as it revealed interactions that were largely undetected by standard detergent-based purification methods . This suggests that traditional approaches may miss important interactions involving membrane proteins like YfbV.

What membrane mimetics are optimal for studying YfbV outside the cell membrane?

Several membrane mimetic systems can maintain YfbV structure outside its native environment, each with distinct advantages:

The peptidisc approach is particularly noteworthy as it allowed detection of numerous membrane protein interactions that were largely undetected by standard detergent-based purification . For YfbV, this approach could reveal native interaction partners while maintaining protein structure.

How might researchers investigate YfbV interactions with other membrane proteins?

While specific YfbV interactions are not directly addressed in current research, powerful methodologies can be adapted to investigate its interaction network:

• Application of peptidisc-based PCP approach:

  • Employing the methodology described in current research specifically targeting YfbV

  • This technique identified over 4900 binary interactions in the E. coli membrane proteome

  • Similar approach with tagged YfbV could reveal its position within the interaction network

• Potential interaction categories to investigate:

  • The Sec translocon (SecYEG complex) involved in protein translocation

  • The Bam complex responsible for outer membrane protein assembly

  • Transport systems like the MetNI complex

  • Membrane-bound chaperones such as YfgM and PpiD

  • Components of trans-periplasmic supercomplexes

• Validation experimental design:

  • Express His-tagged YfbV in SILAC-labeled E. coli

  • Prepare peptidisc libraries from membrane fractions

  • Isolate YfbV complexes via affinity purification

  • Identify co-purifying proteins by quantitative mass spectrometry

  • Conduct reciprocal pulldowns with identified partners

Research indicates that the peptidisc methodology would be particularly valuable as it preserves interactions largely disrupted by detergent solubilization . This suggests traditional approaches might miss important YfbV interactions with other membrane proteins.

What approaches can determine YfbV's role in E. coli O45:K1 pathogenesis?

E. coli O45:K1 is an extraintestinal pathogenic strain, and membrane proteins often play crucial roles in bacterial pathogenesis. To investigate YfbV's potential role:

• Gene knockout studies:

  • Construction of precise yfbV deletion mutants in E. coli O45:K1

  • Phenotypic characterization in:

    • Growth under various conditions (rich media, minimal media, stress conditions)

    • Biofilm formation assays

    • Cell invasion and adhesion models

    • Animal infection models

• Expression analysis during infection:

  • Transcriptomic studies comparing yfbV expression in different infection stages

  • Reporter constructs to monitor yfbV promoter activity during host interaction

  • Proteomic analysis of membrane fractions during infection

• Protein interaction mapping:

  • Identification of interactions with known virulence factors

  • Application of peptidisc methodology to preserve native interactions

  • Crosslinking studies during host-pathogen interaction

• Comparative genomics:

  • Analysis of yfbV conservation across pathogenic and non-pathogenic E. coli strains

  • Identification of sequence variations that correlate with virulence

  • Evolutionary analysis to identify selective pressure

These systematic approaches would establish whether YfbV contributes to E. coli O45:K1 virulence and identify its specific functions during pathogenesis.

What strategies can identify structural or functional domains within YfbV?

Without specific experimental data on YfbV structure, a systematic approach combining computational and experimental methods is recommended:

• Sequence-based domain prediction:

  • Apply tools like SMART, Pfam, and InterPro to identify conserved domains

  • Conduct multiple sequence alignments with homologs to identify conserved motifs

  • Perform hydropathy analysis to predict transmembrane segments using TMHMM or Phobius

  • Check for signal sequences using SignalP

• Structural predictions and analysis:

  • Apply secondary structure prediction using PSIPRED or JPred

  • Generate tertiary structure models using AlphaFold2 or RoseTTAFold

  • Validate predictions through:

    • Limited proteolysis to identify stable domains

    • Hydrogen-deuterium exchange mass spectrometry to map structured regions

• Functional domain mapping:

  • Design and construct truncation variants to map essential regions

  • Perform site-directed mutagenesis of conserved residues

  • Create chimeric proteins with homologs to identify functionally interchangeable regions

• Evolutionary analysis:

  • Compare sequences across bacterial species to identify highly conserved regions

  • Analyze co-evolution patterns that might indicate functional domains

  • Identify residues under selective pressure

The hydrophobic regions in YfbV's sequence, such as "WQIALGGQLGPAVATALFALSLPMQGLWWLGK," are likely to form transmembrane helices. Combining computational predictions with systematic experimental validation would provide the most comprehensive characterization of YfbV's structural domains.