Recombinant Escherichia coli O45:K1 UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag during production.
Synonyms
yciC; ECS88_1325; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGVFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does YciC protein differ across various E. coli strains?

Sequence comparison of YciC across different E. coli strains reveals high conservation with minor variations:

StrainUniProt IDSequence IdentityNotable Differences
E. coli O45:K1 (strain S88/ExPEC)B7ML08Reference sequence-
E. coli ATCC 8739B1ITK0>98%Minor substitutions in non-functional domains
E. coli K-12P21365>97%Variations primarily in loop regions

These comparisons suggest functional conservation across strains, although strain-specific adaptations may exist . When designing experiments, researchers should consider which strain is most appropriate for their specific research question, as minor sequence variations might impact protein behavior in heterologous expression systems.

What expression systems are recommended for recombinant YciC production?

For successful recombinant production of YciC membrane protein, several expression systems have been evaluated:

Expression SystemAdvantagesLimitationsRecommended For
E. coli-basedHigh yield, cost-effective, rapid growthPotential for inclusion bodies, endotoxin contaminationInitial characterization, mutational studies
Yeast (P. pastoris)Better membrane integration, post-translational modificationsLower yield, longer production timeStructural studies requiring native conformation
Baculovirus/insect cellsCloser to native folding, higher complexityMore expensive, technical expertise requiredAdvanced functional studies

For optimal results with E. coli expression systems, it is crucial to grow cells under tightly-controlled conditions and harvest them prior to glucose exhaustion, just before the diauxic shift . This approach has been shown to significantly improve membrane protein yields compared to standard protocols that rely on rapid growth conditions.

What strategies can minimize endotoxin contamination when purifying YciC from E. coli expression systems?

Endotoxin contamination represents a significant challenge when producing recombinant membrane proteins in E. coli. Two effective approaches include:

  • Genetic modification of LPS biosynthesis: Knocking out specific genes in the lipopolysaccharide biosynthesis pathway can reduce endotoxin levels in the final purified protein preparation .

  • Co-expression strategy: Increasing expression of proteins that regulate LPS biosynthesis has shown promising results. For example, upregulation of YciM leads to reduction in the amount of LpxC enzyme involved in LPS biosynthesis, thereby decreasing endotoxin levels in purified recombinant protein samples .

A comparative analysis of endotoxin reduction methods:

MethodPrincipleEfficiencyImplementation Complexity
Gene knockout approachModification of LPS biosynthesis pathwayHigh (>90% reduction)Moderate to high (requires CRISPR-Cas9 or similar techniques)
YciM co-expressionReduction of LpxC enzyme levelsHigh (comparable to knockout approach)Lower (requires only co-expression vector)
Conventional endotoxin removalPhysical separation during purificationModerate (70-85% reduction)Low (additional purification steps)

These approaches should be considered when designing expression systems for YciC, especially when the protein is intended for applications sensitive to endotoxin contamination .

How should experimental design account for variability in YciC membrane protein expression?

When designing experiments to study YciC expression, researchers should implement robust statistical approaches that account for variability:

  • Panel data approach: Implementing a difference-in-differences (DD) estimator with multiple observations per experimental unit can significantly increase statistical power compared to single-point measurements .

  • Serial correlation considerations: Standard power calculation methods for panel data often fail in the presence of arbitrary serial correlation. The Serial-Correlation-Robust (SCR) power calculation formula should be applied:

MDEscr=(t1α/2+tκ)σω2JP(1P)1mr(rψωB+mψωAψωX)MDEscr = (t_{1-\alpha/2} + t_{\kappa})\sqrt{\frac{\sigma^2_\omega}{J \cdot P(1-P)} \cdot \frac{1}{m \cdot r} (r \cdot \psi^B_\omega + m \cdot \psi^A_\omega - \psi^X_\omega)}

where J is sample size, P is proportion of treatment units, m and r are pre- and post-treatment time periods, and ψ\psi terms account for correlation structures .

  • Sample size determination: When planning experiments, the required sample size should be calculated using:

Experiment DurationNaive Power CalculationSCR Power CalculationDifference
Short (m=r=1)J = 120J = 240100% increase
Medium (m=r=6)J = 40J = 95137% increase
Long (m=r=12)J = 25J = 65160% increase

These calculations show that naive power calculations consistently underestimate the required sample size, potentially leading to underpowered experiments .

What are the critical parameters for maintaining stability of purified YciC protein?

Several parameters are critical for maintaining YciC stability after purification:

  • Storage temperature:

    • Short-term storage (up to one week): 4°C in appropriate buffer

    • Medium-term storage (up to 6 months): -20°C

    • Long-term storage (up to 12 months): -80°C

  • Buffer composition:

    • Tris-based buffer with 50% glycerol has been optimized for YciC stability

    • pH 8.0 provides optimal stability for most preparations

  • Handling protocols:

    • Avoid repeated freeze-thaw cycles as this significantly reduces protein integrity

    • For working solutions, prepare small aliquots to minimize freeze-thaw events

Stability can be monitored using the following methods:

MethodParameter MeasuredTimeframeDetection Limit
SDS-PAGEStructural integrityWeekly~5% degradation
Size exclusion chromatographyAggregation stateMonthly2-3% aggregation
Functional assaysActivity retentionBi-monthly10-15% activity loss

Following these guidelines can extend the shelf life and maintain the functional integrity of purified YciC protein preparations .

How can structural characterization of YciC membrane protein be optimized?

Structural characterization of membrane proteins like YciC presents unique challenges. A multi-technique approach is recommended:

  • Crystallography preparation:

    • Identify optimal detergents for extraction (typically DDM, LDAO, or C12E8)

    • Screen lipid compositions for reconstitution and crystal formation

    • Consider lipidic cubic phase (LCP) crystallization for improved crystal packing

  • Cryo-EM sample preparation:

    • Reconstitute in nanodiscs with MSP1D1 scaffold protein

    • Use orthogonal techniques to confirm homogeneity before grid preparation

    • Implement GraFix technique to reduce preferred orientation issues

  • NMR studies:

    • Express isotopically labeled protein (15N, 13C) in minimal media

    • Optimize reconstitution in bicelles (DMPC/DHPC mixtures)

    • Implement TROSY-based pulse sequences for improved resolution

For any structural technique, protein purity >95% is essential, with monodispersity verified by dynamic light scattering prior to structural experiments . The primary bottleneck in membrane protein structural genomics remains reliable protein production, which requires careful optimization of growth conditions and often necessitates high-performance bioreactors to maintain tightly-defined growth regimes .

What effect does growth phase have on YciC expression and how should cultivation be optimized?

The growth phase at harvesting dramatically impacts YciC expression levels and quality. Optimization should follow these guidelines:

  • Growth conditions:

    • The most rapid growth conditions are not optimal for membrane protein production

    • Controlled oxygen levels (30-40% saturation) improve membrane protein integration

    • Temperature reduction to 25-30°C after induction slows expression but improves folding

  • Harvest timing:

    • Cells should be harvested prior to glucose exhaustion

    • Optimal harvest point is just before the diauxic shift

    • This critical timing prevents stress responses that degrade membrane proteins

  • Media optimization:

    • Complex media yields higher biomass but often lower specific protein expression

    • Defined media with controlled carbon/nitrogen ratios improves reproducibility

    • Supplementation with specific amino acids (Leu, Ile, Val) can improve membrane protein folding

Monitoring gene expression via RT-PCR has shown that differences in membrane protein yields under different culture conditions are not necessarily reflected in corresponding mRNA levels, but rather relate to differential expression of genes involved in membrane protein secretion and cellular physiology . This suggests post-transcriptional regulation plays a crucial role in successful membrane protein expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.