Recombinant Escherichia coli O45:K1 UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Escherichia coli O45:K1 UPF0283 membrane protein ycjF (ycjF) is a protein expressed in E. coli using an in vitro expression system . It is shipped with ice packs and is typically in stock. Synonyms for this protein include ycjF, ECS88_1464, and UPF0283 membrane protein YcjF.

Characteristics

  • Source: Escherichia coli O45:K1 (strain S88 / ExPEC)

  • Form: Lyophilized powder

  • Reconstitution: Reconstitute in sterile, deionized water to a concentration of 0.1-1.0 mg/mL, with the recommendation of adding 5-50% glycerol for long-term storage at -20°C/-80°C.

  • Storage: Upon receipt, store at -20°C/-80°C and avoid repeated freeze-thaw cycles.

  • Tag Information: Tag type is determined during manufacturing; specific tag requests can be made during order placement.

  • Buffer Before Lyophilization: Tris/PBS-based buffer, 6% Trehalose

  • Expression Region: 1-353

  • Protein Length: Full length protein

  • UniProt No.: B7MLZ8

Sequence Information

The target protein sequence for Escherichia coli O45:K1 UPF0283 membrane protein ycjF (ycjF) is:

MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL
RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV
TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE
TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN
RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG
AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK

Function and Location

The ycjF protein belongs to the UPF0283 family. It is located in the cell inner membrane and is a multi-pass membrane protein. The precise function of YcjF in E. coli O45:K1 is not well-defined, but it is annotated as an inner membrane protein .

Database Links

Relevant database links include:

  • KEGG: ecz:ECS88_1464

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To ensure a specific tag, please specify this during your order; we will prioritize your request.
Synonyms
ycjF; ECS88_1464; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the ycjF gene in E. coli?

The ycjF gene is part of a larger gene cluster in E. coli K-12 that includes the ycjM-W and ompG genes. This 12-gene cluster is believed to function as a catabolic pathway for carbohydrate metabolism . The ycjF gene specifically encodes a UPF0283 family membrane protein. This gene is positioned within the basic genome of E. coli, which is subject to exchange via homologous recombination with genome fragments acquired from other genomes in the population . For researchers interested in ycjF, it is crucial to understand its relationship with other genes in the ycj cluster, particularly ycjQ, ycjR, and ycjS, which have been characterized as enzymes involved in carbohydrate modification pathways .

How is ycjF classified within membrane protein families?

The ycjF gene encodes a protein classified as part of the UPF0283 family of membrane proteins. UPF (Uncharacterized Protein Family) designations indicate proteins whose functions have not been fully characterized experimentally. For researchers approaching the study of ycjF, it is important to note that while structural information may be predicted through computational methods, functional characterization requires experimental validation. The protein's membrane localization suggests it may function in transport, signaling, or as part of a membrane-associated metabolic complex, possibly related to the carbohydrate metabolism functions demonstrated for other proteins in the ycj gene cluster .

What are the predicted structural features of the ycjF protein?

Based on bioinformatic analyses of the UPF0283 family, the ycjF protein is predicted to contain multiple transmembrane domains that anchor it within the bacterial cell membrane. Researchers studying this protein should consider employing multiple prediction algorithms (TMHMM, TopPred, HMMTOP) to generate a consensus topology model before undertaking experimental verification. Hydropathy plot analysis and membrane protein topology prediction tools should be used to identify potential membrane-spanning regions, followed by experimental verification through techniques such as PhoA fusion analysis or cysteine-scanning mutagenesis. The protein likely contains conserved residues that may be important for its function, potentially related to the carbohydrate metabolism activities observed in neighboring genes of the ycj cluster .

How can researchers effectively clone and express the ycjF gene?

For efficient cloning of the ycjF gene from E. coli O45:K1, researchers should employ a similar approach to that used for other genes in the ycj cluster. Based on methodologies used for ycjQ and ycjS , the following protocol is recommended:

  • Design primers that include appropriate restriction sites (e.g., EcoRI and HindIII) for directional cloning:

    • Forward primer: 5'-ACCGTGAATTCATG[ycjF start sequence]-3'

    • Reverse primer: 5'-AATCCAAGCTTTCA[ycjF end sequence]-3'

  • Amplify the gene from genomic DNA using high-fidelity polymerase.

  • Clone into an expression vector (e.g., pET-30a(+)) to facilitate expression with an N-terminal His6-tag for purification.

  • Transform into an appropriate E. coli expression strain (e.g., BL-21(DE3)).

  • Express under optimized conditions, typically induction with IPTG at OD600 = 0.6-0.8, followed by growth at 25-30°C to minimize inclusion body formation of membrane proteins.

For membrane proteins like ycjF, expression conditions should be carefully optimized to prevent protein aggregation. Consider using specialized strains like C41(DE3) or C43(DE3) that are designed for membrane protein expression .

What approaches should be used to elucidate the function of ycjF in relation to the ycj gene cluster?

To investigate the function of ycjF within the context of the ycj gene cluster, researchers should employ a multi-faceted approach:

  • Gene knockout studies: Create a ycjF deletion mutant and analyze phenotypic changes, particularly focusing on carbohydrate utilization patterns.

  • Transcriptional analysis: Perform RT-qPCR to determine if ycjF is co-expressed with other genes in the cluster (particularly ycjQ, ycjR, and ycjS) under various growth conditions.

  • Protein-protein interaction studies: Use bacterial two-hybrid systems or co-immunoprecipitation to identify potential interactions between ycjF and other proteins in the ycj cluster.

  • Metabolomic analysis: Compare metabolite profiles between wild-type and ycjF knockout strains when grown on various carbon sources, particularly focusing on the carbohydrates processed by YcjQ, YcjR, and YcjS enzymes .

  • Complementation studies: Reintroduce the ycjF gene on a plasmid to confirm that observed phenotypes are specifically due to the absence of ycjF.

Given that YcjQ, YcjR, and YcjS constitute a metabolic pathway for transforming d-gulosides to d-glucosides , researchers should investigate whether ycjF plays a role in this pathway, possibly as a transporter for these sugars or their derivatives.

What purification strategies are most effective for the ycjF membrane protein?

Purifying membrane proteins like ycjF requires specialized approaches:

Table 1: Recommended Purification Protocol for ycjF Membrane Protein

StepProcedureKey ParametersNotes
1Cell lysisFrench press or sonication in buffer containing protease inhibitorsGentle lysis preserves membrane integrity
2Membrane fraction isolationUltracentrifugation at 100,000 × g for 1 hourMembrane proteins partition into the pellet
3Membrane solubilizationDetergent screening (DDM, LDAO, FC-12)Start with 1% detergent; optimize concentration
4Affinity purificationNi-NTA chromatography (for His-tagged protein)Include detergent in all buffers
5Size exclusion chromatographySuperdex 200 columnRemoves aggregates and assesses oligomeric state
6Detergent exchange (optional)Dialysis or on-column exchangeMay be necessary for functional or structural studies

For membrane proteins like ycjF, it's critical to maintain a stable detergent micelle throughout purification. Researchers should test multiple detergents to identify one that maintains protein stability and activity. For functional studies, consider reconstitution into proteoliposomes using E. coli lipids to recreate a native-like membrane environment .

How can researchers assess the enzymatic activity of ycjF?

Based on the characterized activities of related proteins in the ycj cluster , researchers should consider the following approaches to assess potential enzymatic activity of ycjF:

  • Substrate screening: Test various carbohydrates, particularly those related to d-glucose and d-gulose derivatives, as potential substrates.

  • Coupled enzyme assays: Similar to the NAD+/NADH-dependent assays used for YcjQ and YcjS , develop coupled assays that can detect changes in specific metabolites.

  • Transport assays: If ycjF functions as a transporter, perform uptake studies using radiolabeled or fluorescently labeled substrates in proteoliposomes.

  • Activity reconstitution: Co-purify ycjF with other proteins from the ycj cluster to test if they form a functional complex.

Activity measurements should be performed under various conditions (pH, temperature, ionic strength) to determine optimal parameters. Controls should include heat-inactivated enzyme and assays performed in the absence of key cofactors .

What structural biology techniques are most suitable for determining the three-dimensional structure of ycjF?

For membrane proteins like ycjF, several complementary structural biology approaches are recommended:

  • X-ray crystallography: Requires pure, homogeneous, and stable protein preparations. For membrane proteins like ycjF:

    • Screen multiple detergents and lipid additives to enhance stability

    • Use lipidic cubic phase (LCP) crystallization techniques

    • Consider fusion proteins (e.g., T4 lysozyme insertion) to increase crystallizability

  • Cryo-electron microscopy (cryo-EM): Particularly valuable for membrane proteins:

    • Prepare protein in detergent micelles, nanodiscs, or amphipols

    • Optimize sample concentration and grid preparation conditions

    • Consider whether the protein size is suitable for single-particle analysis (typically >100 kDa)

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • For specific domains or if the full protein is amenable to solution NMR

    • Requires isotopic labeling (15N, 13C, 2H)

    • Consider solid-state NMR for membrane-embedded regions

  • Integrative structural biology approaches:

    • Combine low-resolution techniques (SAXS, SANS) with computational modeling

    • Use crosslinking mass spectrometry to identify spatial constraints

    • Employ evolutionary coupling analysis to predict contacts between amino acids

Each technique has specific sample preparation requirements that must be optimized for membrane proteins .

How can advanced bioinformatics approaches help predict ycjF function?

Given the limited experimental characterization of ycjF, advanced bioinformatics approaches can provide valuable functional insights:

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-occurring genes across species

    • Analysis of selection pressure on different protein regions

    • Identification of conserved motifs that might indicate function

  • Structural prediction:

    • Use AlphaFold2 or RoseTTAFold to generate structural models

    • Identify potential ligand-binding pockets

    • Compare with structures of functionally characterized proteins

  • Gene neighborhood analysis:

    • Examine conservation of the ycj gene cluster across bacteria

    • Identify functional linkages based on consistently co-located genes

    • Analyze operonic structures and potential co-regulation

  • Protein-protein interaction networks:

    • Predict interaction partners using co-expression data

    • Use structure-based prediction of protein-protein interactions

    • Integrate with experimental proteomic data where available

These approaches should be viewed as generating hypotheses that require experimental validation. Given the known functions of YcjQ, YcjR, and YcjS in carbohydrate metabolism , computational analyses should focus on potential roles in related metabolic pathways.

Which expression systems are most appropriate for recombinant production of ycjF?

For the recombinant expression of ycjF, researchers should consider several expression systems, each with advantages and limitations:

Table 2: Comparison of Expression Systems for ycjF Production

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coli (BL21(DE3))Native host, simple cultivation, high yieldsPotential toxicity of membrane protein overexpressionUse tunable promoters (e.g., pBAD), low temperature induction (16-25°C)
E. coli C41/C43(DE3)Engineered for membrane protein expressionMay still have challenges with complex proteinsOptimize inducer concentration, use molecular chaperones (GroEL/ES)
Cell-free systemsAvoids toxicity issues, direct access to reaction environmentLower yields, higher costSupplement with membrane mimetics (nanodiscs, liposomes)
Yeast (P. pastoris)Eukaryotic folding machinery, scalableDifferent membrane compositionOptimize copy number, induction strategy
Mammalian cellsComplex folding and PTM machineryTime-consuming, expensiveConsider transient expression systems, inducible promoters

What strategies can improve the solubility and stability of recombinant ycjF?

Enhancing the solubility and stability of ycjF requires specialized approaches for membrane proteins:

  • Expression optimization:

    • Reduce expression rate using lower temperatures (16-25°C) and reduced inducer concentrations

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Use specialized strains with enhanced membrane protein processing capacity

  • Construct engineering:

    • Create fusion proteins with solubility enhancers (MBP, SUMO, Mistic)

    • Consider truncation constructs to identify stable domains

    • Introduce mutations to remove aggregation-prone regions based on computational prediction

  • Buffer optimization:

    • Screen multiple detergents (maltoside, glucoside, and fos-choline-based)

    • Include stabilizing additives (glycerol, specific lipids, cholesterol hemisuccinate)

    • Optimize ionic strength and pH based on predicted isoelectric point

  • Advanced stabilization:

    • Thermostability assays to identify optimal conditions

    • Nanobody or antibody fragment co-purification to stabilize specific conformations

    • Reconstitution into nanodiscs or SMALPs for a more native-like environment

Using these approaches in combination can significantly improve the yield of functional ycjF protein for downstream applications .

How does ycjF contribute to E. coli metabolism within the broader context of the ycj gene cluster?

While specific information about ycjF's role is limited, its inclusion in the ycj gene cluster suggests it participates in the carbohydrate metabolism pathway identified for other genes in this cluster. Based on the characterized functions of YcjQ, YcjR, and YcjS , researchers should investigate:

  • Metabolic pathway integration:

    • YcjQ functions as a 3-keto-d-guloside dehydrogenase

    • YcjR acts as a C-4 epimerase converting 3-keto-d-gulopyranosides to 3-keto-d-glucopyranosides

    • YcjS serves as a 3-keto-d-glucoside dehydrogenase

    • YcjF may function as a transporter for these metabolites or as a regulatory protein

  • Metabolic flux analysis:

    • Compare carbon flux through this pathway in wild-type vs. ycjF knockout strains

    • Use 13C-labeled substrates to track metabolite conversion

    • Quantify changes in pathway intermediates and end products

  • Regulatory network analysis:

    • Identify transcription factors controlling ycjF expression

    • Determine whether ycjF is co-regulated with other genes in the cluster

    • Investigate environmental signals that modulate expression

  • Physiological significance:

    • Determine growth phenotypes on different carbon sources

    • Assess competitive fitness under various environmental conditions

    • Examine potential roles in biofilm formation or stress responses

Understanding ycjF's role requires considering both its direct biochemical function and its broader contributions to bacterial physiology .

What advanced genetic approaches can be used to study ycjF function in E. coli O45:K1?

Modern genetic tools offer powerful approaches for detailed functional analysis of ycjF:

  • CRISPR-Cas9 genome editing:

    • Generate precise deletions, insertions, or point mutations

    • Create conditional knockdowns using CRISPRi

    • Introduce reporter tags at the native locus

  • Random mutagenesis and selection:

    • Perform error-prone PCR to generate ycjF variants

    • Select for altered phenotypes (growth rate, substrate utilization)

    • Identify critical residues through sequence analysis of selected variants

  • Transposon sequencing (Tn-Seq):

    • Identify genetic interactions by comparing transposon insertion profiles in wild-type vs. ycjF mutant backgrounds

    • Discover synthetic lethal or synthetic viable interactions

  • Ribosome profiling:

    • Measure translation efficiency of ycjF under different conditions

    • Identify potential regulatory mechanisms at the translational level

  • Single-cell approaches:

    • Use fluorescent reporters to examine cell-to-cell variability in ycjF expression

    • Apply microfluidics to observe dynamic responses to environmental changes

These approaches should be integrated with biochemical and physiological studies to develop a comprehensive understanding of ycjF function within the broader context of E. coli metabolism and the ycj gene cluster .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.