Recombinant Escherichia coli O45:K1 UPF0283 membrane protein ycjF (ycjF) is a protein expressed in E. coli using an in vitro expression system . It is shipped with ice packs and is typically in stock. Synonyms for this protein include ycjF, ECS88_1464, and UPF0283 membrane protein YcjF.
Source: Escherichia coli O45:K1 (strain S88 / ExPEC)
Form: Lyophilized powder
Reconstitution: Reconstitute in sterile, deionized water to a concentration of 0.1-1.0 mg/mL, with the recommendation of adding 5-50% glycerol for long-term storage at -20°C/-80°C.
Storage: Upon receipt, store at -20°C/-80°C and avoid repeated freeze-thaw cycles.
Tag Information: Tag type is determined during manufacturing; specific tag requests can be made during order placement.
Buffer Before Lyophilization: Tris/PBS-based buffer, 6% Trehalose
Expression Region: 1-353
Protein Length: Full length protein
UniProt No.: B7MLZ8
The target protein sequence for Escherichia coli O45:K1 UPF0283 membrane protein ycjF (ycjF) is:
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL
RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV
TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE
TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN
RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG
AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
The ycjF protein belongs to the UPF0283 family. It is located in the cell inner membrane and is a multi-pass membrane protein. The precise function of YcjF in E. coli O45:K1 is not well-defined, but it is annotated as an inner membrane protein .
Relevant database links include:
KEGG: ecz:ECS88_1464
KEGG: ecz:ECS88_1464
The ycjF gene is part of a larger gene cluster in E. coli K-12 that includes the ycjM-W and ompG genes. This 12-gene cluster is believed to function as a catabolic pathway for carbohydrate metabolism . The ycjF gene specifically encodes a UPF0283 family membrane protein. This gene is positioned within the basic genome of E. coli, which is subject to exchange via homologous recombination with genome fragments acquired from other genomes in the population . For researchers interested in ycjF, it is crucial to understand its relationship with other genes in the ycj cluster, particularly ycjQ, ycjR, and ycjS, which have been characterized as enzymes involved in carbohydrate modification pathways .
The ycjF gene encodes a protein classified as part of the UPF0283 family of membrane proteins. UPF (Uncharacterized Protein Family) designations indicate proteins whose functions have not been fully characterized experimentally. For researchers approaching the study of ycjF, it is important to note that while structural information may be predicted through computational methods, functional characterization requires experimental validation. The protein's membrane localization suggests it may function in transport, signaling, or as part of a membrane-associated metabolic complex, possibly related to the carbohydrate metabolism functions demonstrated for other proteins in the ycj gene cluster .
Based on bioinformatic analyses of the UPF0283 family, the ycjF protein is predicted to contain multiple transmembrane domains that anchor it within the bacterial cell membrane. Researchers studying this protein should consider employing multiple prediction algorithms (TMHMM, TopPred, HMMTOP) to generate a consensus topology model before undertaking experimental verification. Hydropathy plot analysis and membrane protein topology prediction tools should be used to identify potential membrane-spanning regions, followed by experimental verification through techniques such as PhoA fusion analysis or cysteine-scanning mutagenesis. The protein likely contains conserved residues that may be important for its function, potentially related to the carbohydrate metabolism activities observed in neighboring genes of the ycj cluster .
For efficient cloning of the ycjF gene from E. coli O45:K1, researchers should employ a similar approach to that used for other genes in the ycj cluster. Based on methodologies used for ycjQ and ycjS , the following protocol is recommended:
Design primers that include appropriate restriction sites (e.g., EcoRI and HindIII) for directional cloning:
Forward primer: 5'-ACCGTGAATTCATG[ycjF start sequence]-3'
Reverse primer: 5'-AATCCAAGCTTTCA[ycjF end sequence]-3'
Amplify the gene from genomic DNA using high-fidelity polymerase.
Clone into an expression vector (e.g., pET-30a(+)) to facilitate expression with an N-terminal His6-tag for purification.
Transform into an appropriate E. coli expression strain (e.g., BL-21(DE3)).
Express under optimized conditions, typically induction with IPTG at OD600 = 0.6-0.8, followed by growth at 25-30°C to minimize inclusion body formation of membrane proteins.
For membrane proteins like ycjF, expression conditions should be carefully optimized to prevent protein aggregation. Consider using specialized strains like C41(DE3) or C43(DE3) that are designed for membrane protein expression .
To investigate the function of ycjF within the context of the ycj gene cluster, researchers should employ a multi-faceted approach:
Gene knockout studies: Create a ycjF deletion mutant and analyze phenotypic changes, particularly focusing on carbohydrate utilization patterns.
Transcriptional analysis: Perform RT-qPCR to determine if ycjF is co-expressed with other genes in the cluster (particularly ycjQ, ycjR, and ycjS) under various growth conditions.
Protein-protein interaction studies: Use bacterial two-hybrid systems or co-immunoprecipitation to identify potential interactions between ycjF and other proteins in the ycj cluster.
Metabolomic analysis: Compare metabolite profiles between wild-type and ycjF knockout strains when grown on various carbon sources, particularly focusing on the carbohydrates processed by YcjQ, YcjR, and YcjS enzymes .
Complementation studies: Reintroduce the ycjF gene on a plasmid to confirm that observed phenotypes are specifically due to the absence of ycjF.
Given that YcjQ, YcjR, and YcjS constitute a metabolic pathway for transforming d-gulosides to d-glucosides , researchers should investigate whether ycjF plays a role in this pathway, possibly as a transporter for these sugars or their derivatives.
Purifying membrane proteins like ycjF requires specialized approaches:
| Step | Procedure | Key Parameters | Notes |
|---|---|---|---|
| 1 | Cell lysis | French press or sonication in buffer containing protease inhibitors | Gentle lysis preserves membrane integrity |
| 2 | Membrane fraction isolation | Ultracentrifugation at 100,000 × g for 1 hour | Membrane proteins partition into the pellet |
| 3 | Membrane solubilization | Detergent screening (DDM, LDAO, FC-12) | Start with 1% detergent; optimize concentration |
| 4 | Affinity purification | Ni-NTA chromatography (for His-tagged protein) | Include detergent in all buffers |
| 5 | Size exclusion chromatography | Superdex 200 column | Removes aggregates and assesses oligomeric state |
| 6 | Detergent exchange (optional) | Dialysis or on-column exchange | May be necessary for functional or structural studies |
For membrane proteins like ycjF, it's critical to maintain a stable detergent micelle throughout purification. Researchers should test multiple detergents to identify one that maintains protein stability and activity. For functional studies, consider reconstitution into proteoliposomes using E. coli lipids to recreate a native-like membrane environment .
Based on the characterized activities of related proteins in the ycj cluster , researchers should consider the following approaches to assess potential enzymatic activity of ycjF:
Substrate screening: Test various carbohydrates, particularly those related to d-glucose and d-gulose derivatives, as potential substrates.
Coupled enzyme assays: Similar to the NAD+/NADH-dependent assays used for YcjQ and YcjS , develop coupled assays that can detect changes in specific metabolites.
Transport assays: If ycjF functions as a transporter, perform uptake studies using radiolabeled or fluorescently labeled substrates in proteoliposomes.
Activity reconstitution: Co-purify ycjF with other proteins from the ycj cluster to test if they form a functional complex.
Activity measurements should be performed under various conditions (pH, temperature, ionic strength) to determine optimal parameters. Controls should include heat-inactivated enzyme and assays performed in the absence of key cofactors .
For membrane proteins like ycjF, several complementary structural biology approaches are recommended:
X-ray crystallography: Requires pure, homogeneous, and stable protein preparations. For membrane proteins like ycjF:
Screen multiple detergents and lipid additives to enhance stability
Use lipidic cubic phase (LCP) crystallization techniques
Consider fusion proteins (e.g., T4 lysozyme insertion) to increase crystallizability
Cryo-electron microscopy (cryo-EM): Particularly valuable for membrane proteins:
Prepare protein in detergent micelles, nanodiscs, or amphipols
Optimize sample concentration and grid preparation conditions
Consider whether the protein size is suitable for single-particle analysis (typically >100 kDa)
Nuclear Magnetic Resonance (NMR) spectroscopy:
For specific domains or if the full protein is amenable to solution NMR
Requires isotopic labeling (15N, 13C, 2H)
Consider solid-state NMR for membrane-embedded regions
Integrative structural biology approaches:
Combine low-resolution techniques (SAXS, SANS) with computational modeling
Use crosslinking mass spectrometry to identify spatial constraints
Employ evolutionary coupling analysis to predict contacts between amino acids
Each technique has specific sample preparation requirements that must be optimized for membrane proteins .
Given the limited experimental characterization of ycjF, advanced bioinformatics approaches can provide valuable functional insights:
Evolutionary analysis:
Phylogenetic profiling to identify co-occurring genes across species
Analysis of selection pressure on different protein regions
Identification of conserved motifs that might indicate function
Structural prediction:
Use AlphaFold2 or RoseTTAFold to generate structural models
Identify potential ligand-binding pockets
Compare with structures of functionally characterized proteins
Gene neighborhood analysis:
Examine conservation of the ycj gene cluster across bacteria
Identify functional linkages based on consistently co-located genes
Analyze operonic structures and potential co-regulation
Protein-protein interaction networks:
Predict interaction partners using co-expression data
Use structure-based prediction of protein-protein interactions
Integrate with experimental proteomic data where available
These approaches should be viewed as generating hypotheses that require experimental validation. Given the known functions of YcjQ, YcjR, and YcjS in carbohydrate metabolism , computational analyses should focus on potential roles in related metabolic pathways.
For the recombinant expression of ycjF, researchers should consider several expression systems, each with advantages and limitations:
| Expression System | Advantages | Disadvantages | Optimization Strategies |
|---|---|---|---|
| E. coli (BL21(DE3)) | Native host, simple cultivation, high yields | Potential toxicity of membrane protein overexpression | Use tunable promoters (e.g., pBAD), low temperature induction (16-25°C) |
| E. coli C41/C43(DE3) | Engineered for membrane protein expression | May still have challenges with complex proteins | Optimize inducer concentration, use molecular chaperones (GroEL/ES) |
| Cell-free systems | Avoids toxicity issues, direct access to reaction environment | Lower yields, higher cost | Supplement with membrane mimetics (nanodiscs, liposomes) |
| Yeast (P. pastoris) | Eukaryotic folding machinery, scalable | Different membrane composition | Optimize copy number, induction strategy |
| Mammalian cells | Complex folding and PTM machinery | Time-consuming, expensive | Consider transient expression systems, inducible promoters |
Enhancing the solubility and stability of ycjF requires specialized approaches for membrane proteins:
Expression optimization:
Reduce expression rate using lower temperatures (16-25°C) and reduced inducer concentrations
Co-express with molecular chaperones (GroEL/ES, DnaK/J)
Use specialized strains with enhanced membrane protein processing capacity
Construct engineering:
Create fusion proteins with solubility enhancers (MBP, SUMO, Mistic)
Consider truncation constructs to identify stable domains
Introduce mutations to remove aggregation-prone regions based on computational prediction
Buffer optimization:
Screen multiple detergents (maltoside, glucoside, and fos-choline-based)
Include stabilizing additives (glycerol, specific lipids, cholesterol hemisuccinate)
Optimize ionic strength and pH based on predicted isoelectric point
Advanced stabilization:
Thermostability assays to identify optimal conditions
Nanobody or antibody fragment co-purification to stabilize specific conformations
Reconstitution into nanodiscs or SMALPs for a more native-like environment
Using these approaches in combination can significantly improve the yield of functional ycjF protein for downstream applications .
While specific information about ycjF's role is limited, its inclusion in the ycj gene cluster suggests it participates in the carbohydrate metabolism pathway identified for other genes in this cluster. Based on the characterized functions of YcjQ, YcjR, and YcjS , researchers should investigate:
Metabolic pathway integration:
YcjQ functions as a 3-keto-d-guloside dehydrogenase
YcjR acts as a C-4 epimerase converting 3-keto-d-gulopyranosides to 3-keto-d-glucopyranosides
YcjS serves as a 3-keto-d-glucoside dehydrogenase
YcjF may function as a transporter for these metabolites or as a regulatory protein
Metabolic flux analysis:
Compare carbon flux through this pathway in wild-type vs. ycjF knockout strains
Use 13C-labeled substrates to track metabolite conversion
Quantify changes in pathway intermediates and end products
Regulatory network analysis:
Identify transcription factors controlling ycjF expression
Determine whether ycjF is co-regulated with other genes in the cluster
Investigate environmental signals that modulate expression
Physiological significance:
Determine growth phenotypes on different carbon sources
Assess competitive fitness under various environmental conditions
Examine potential roles in biofilm formation or stress responses
Understanding ycjF's role requires considering both its direct biochemical function and its broader contributions to bacterial physiology .
Modern genetic tools offer powerful approaches for detailed functional analysis of ycjF:
CRISPR-Cas9 genome editing:
Generate precise deletions, insertions, or point mutations
Create conditional knockdowns using CRISPRi
Introduce reporter tags at the native locus
Random mutagenesis and selection:
Perform error-prone PCR to generate ycjF variants
Select for altered phenotypes (growth rate, substrate utilization)
Identify critical residues through sequence analysis of selected variants
Transposon sequencing (Tn-Seq):
Identify genetic interactions by comparing transposon insertion profiles in wild-type vs. ycjF mutant backgrounds
Discover synthetic lethal or synthetic viable interactions
Ribosome profiling:
Measure translation efficiency of ycjF under different conditions
Identify potential regulatory mechanisms at the translational level
Single-cell approaches:
Use fluorescent reporters to examine cell-to-cell variability in ycjF expression
Apply microfluidics to observe dynamic responses to environmental changes
These approaches should be integrated with biochemical and physiological studies to develop a comprehensive understanding of ycjF function within the broader context of E. coli metabolism and the ycj gene cluster .