Recombinant Escherichia coli O45:K1 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Escherichia coli O45:K1 UPF0761 membrane protein YihY is a 290-amino-acid protein encoded by the yihY gene. It is classified as a UPF0761 family membrane protein and is expressed with an N-terminal His tag for purification . Key features include:

PropertyDetails
UniProt IDB7MI17 (O45:K1 strain-specific)
Molecular Weight~33 kDa (theoretical, based on amino acid sequence)
Expression SystemE. coli
TagN-terminal His tag
Purity≥85–90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Role in Bacterial Virulence

Studies on the O45:K1 strain highlight YihY’s indirect association with virulence factors such as curli fibers, which promote biofilm formation and immune evasion :

Pathogenic MechanismExperimental Findings
Biofilm formationCurli-producing O45:K1 strains exhibit enhanced biofilm growth at 37°C .
Host defense resistanceBiofilms resist LL-37 (human antimicrobial peptide), aiding bladder colonization .
Genetic regulationyihY interacts with purine biosynthesis (purF) and Rcs phosphorelay systems .

Recombinant Production

  • Expression: Optimized in E. coli with codon-adapted vectors for high yield .

  • Purification: Affinity chromatography using His-tag protocols .

  • Reconstitution: Solubilized in Tris/PBS buffers with glycerol (5–50%) for stability .

Research Applications

  • Antigen development: Used in ELISA kits for antibody production .

  • Structural studies: Membrane protein dynamics and interactions .

  • Pathogenesis models: Mouse bladder colonization assays .

Research Gaps and Future Directions

  • Functional characterization: The exact biochemical role of YihY remains undefined .

  • Therapeutic potential: Targeting YihY-regulated pathways could disrupt biofilm formation in UTIs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yihY; ECS88_4331; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISAYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAEKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Escherichia coli O45:K1 UPF0761 membrane protein yihY?

The yihY protein is a 290-amino acid membrane protein belonging to the Uncharacterized Protein Family (UPF0761). The recombinant form used in research typically contains an N-terminal His tag for purification purposes and is expressed in E. coli expression systems. As a membrane protein, it contains multiple predicted transmembrane domains and is thought to be integrated into the bacterial membrane, though its precise biological function remains to be fully characterized .

What is the purpose of the His tag in the recombinant yihY protein?

The His tag (histidine tag) serves multiple research purposes in the recombinant yihY protein:

  • It enables efficient purification using immobilized metal affinity chromatography (IMAC)

  • It facilitates detection of the protein using anti-His antibodies in techniques like Western blotting

  • It allows for immobilization of the protein on surfaces for interaction studies

  • Its small size minimizes interference with protein structure and function compared to larger tags

How should I design controlled experiments to study yihY protein function?

When designing experiments to investigate yihY function, it's critical to follow proper experimental design principles:

  • Identify a single variable to test in each experiment while keeping all other factors constant

  • Include appropriate controls:

    • Negative controls (buffer-only, irrelevant protein with similar tag)

    • Positive controls (characterized membrane protein with known function)

    • Expression controls (empty vector)

    • Tag controls (tag-only protein)

  • Ensure consistent experimental conditions across all trials

  • Maintain the same amount of mass or concentration in comparative experiments

  • Measure results using standardized, quantifiable metrics

  • Perform sufficient replicates for statistical analysis4

What are the optimal storage and handling conditions for recombinant yihY protein?

For optimal stability and activity of recombinant yihY protein:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Long-term storage: Store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as these can degrade the protein

  • The protein is typically stored in Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • For extended storage, adding glycerol to a final concentration of 50% is recommended

  • Centrifuge the vial briefly before opening to bring contents to the bottom

How should I reconstitute lyophilized yihY protein for experimental use?

To properly reconstitute lyophilized yihY protein:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for stability (50% is standard)

  • Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Store reconstituted protein at -20°C/-80°C for long-term storage

What techniques are most appropriate for studying yihY localization in bacterial membranes?

To determine the precise localization and topology of yihY within bacterial membranes:

  • Membrane fractionation: Separate inner and outer membranes using sucrose gradient ultracentrifugation

  • Fluorescent protein fusions: Create yihY-GFP fusions for visualization in live cells

  • Immunofluorescence microscopy: Use anti-His antibodies to detect the tagged protein

  • Protease accessibility assays: Determine topology by exposing membrane vesicles to proteases

  • PhoA/LacZ fusion analysis: Create reporter fusions at different positions to map membrane topology

  • Super-resolution microscopy: Techniques like STORM or PALM for nanoscale localization patterns

These approaches provide complementary information about the protein's spatial organization within the bacterial membrane system.

How can I investigate potential interactions between yihY and other bacterial proteins?

To identify and characterize protein-protein interactions involving yihY:

  • Co-immunoprecipitation: Pull down yihY using anti-His antibodies and identify co-precipitating proteins

  • Bacterial two-hybrid system: Specialized for membrane proteins to detect in vivo interactions

  • Chemical cross-linking: Cross-link proteins in proximity followed by mass spectrometry identification

  • FRET assays: Use fluorescently tagged proteins to detect interactions in live bacteria

  • Split-ubiquitin membrane yeast two-hybrid: Alternative system optimized for membrane protein interactions

  • Differential proteomics: Compare membrane protein complexes between wild-type and yihY knockout strains

Each method has specific advantages and limitations; combining multiple approaches provides the most comprehensive interaction profile.

What statistical approaches should I use when analyzing functional data for yihY experiments?

Analysis ScenarioRecommended Statistical ApproachKey Considerations
Comparing wild-type vs. mutantStudent's t-test or ANOVAVerify normality assumptions; use Tukey's post-hoc test for multiple comparisons
Dose-response experimentsNon-linear regressionDetermine EC50/IC50 values and Hill coefficients
Time-course studiesRepeated measures ANOVAAccount for temporal autocorrelation
High-throughput screensZ-factor calculationAssess assay quality; apply FDR correction for multiple testing
Correlation analysesPearson's or Spearman's correlationSelect based on linearity and distribution of data

Always report sample sizes, number of replicates, measures of dispersion (SD/SEM), and p-values with appropriate significance thresholds.

How can I address solubility challenges when working with the yihY membrane protein?

Membrane proteins like yihY present unique solubility challenges that can be addressed through:

  • Detergent optimization:

    • Screen multiple detergent types (DDM, LDAO, CHAPS)

    • Test different detergent concentrations

    • Consider detergent mixtures for improved solubility

  • Buffer optimization:

    • Adjust salt concentration (typically 150-500 mM)

    • Test pH range (usually 7.0-8.5)

    • Add stabilizing agents (glycerol, specific lipids)

  • Alternative solubilization approaches:

    • Use amphipols for detergent-free handling

    • Employ nanodiscs for a more native-like environment

    • Consider styrene maleic acid lipid particles (SMALPs)

  • Expression optimization:

    • Lower expression temperature (16-25°C)

    • Reduce induction levels

    • Use specialized expression strains

Document solubility improvements quantitatively through techniques like light scattering or analytical ultracentrifugation.

How can I verify the integrity and potential activity of purified yihY protein?

To confirm that purified yihY maintains its structural integrity and potential functionality:

  • SDS-PAGE and Western blotting: Verify correct size and purity (>90% as specified in the product information)

  • Circular dichroism: Assess secondary structure elements, particularly important for alpha-helical membrane proteins

  • Size exclusion chromatography: Detect potential aggregation or oligomerization

  • Thermal shift assays: Evaluate protein stability under different buffer conditions

  • Reconstitution into liposomes: Test membrane insertion efficiency

  • Functional complementation: Assess ability to restore function in yihY knockout strains

These approaches provide a comprehensive assessment of protein quality before proceeding with more specific functional assays .

What experimental approaches can reveal the biological function of yihY?

To elucidate the currently unknown function of this UPF0761 family protein:

  • Genetic approaches:

    • Create precise gene knockouts and characterize resulting phenotypes

    • Perform complementation studies with wild-type and mutant forms

    • Conduct suppressor screens to identify genetic interactions

  • Biochemical approaches:

    • Test substrate binding using thermal shift assays

    • Perform activity assays based on predicted function (transport, enzymatic)

    • Analyze lipid interactions and effects on membrane properties

  • Structural biology:

    • Determine 3D structure through X-ray crystallography or cryo-EM

    • Use molecular dynamics simulations to predict functional movements

  • Systems biology:

    • Perform transcriptomic analysis of knockout strains

    • Identify conditions where yihY expression is significantly altered

    • Map the protein into known interaction networks

Each approach provides complementary information that, together, can reveal the biological role of this uncharacterized protein.

How might yihY contribute to bacterial membrane biology and potential pathogenesis?

The potential roles of yihY in bacterial physiology and pathogenesis can be investigated through:

  • Expression analysis:

    • Measure yihY expression under various stress conditions

    • Compare expression in pathogenic versus commensal conditions

  • Virulence assessment:

    • Compare virulence between wild-type and yihY-deficient strains

    • Test contribution to antibiotic resistance or persistence

  • Membrane function analysis:

    • Examine membrane integrity in knockout strains

    • Assess membrane potential and permeability

  • Comparative genomics:

    • Analyze conservation and variation across E. coli strains

    • Identify pathogen-specific features of yihY

Understanding these aspects could reveal whether yihY represents a potential therapeutic target for antimicrobial development.

What data table structure is recommended for documenting yihY experimental results?

When organizing experimental results for publication or laboratory documentation:

Data CategoryEssential ElementsExample Format
Expression yieldsStrain, induction conditions, quantification methodTable with mg/L values across conditions
Purification resultsPurification steps, recovery percentages, purity assessmentProgressive yield table with SDS-PAGE image
Functional assaysAssay conditions, quantitative readouts, statistical analysisResults with controls, biological replicates
Mutant phenotypesMutation details, growth conditions, quantitative metricsComparative table with wild-type values
Interaction dataInteraction partners, detection method, interaction strengthNetwork diagram with confidence scores

Documentation should follow NIH data table standards for clarity, reproducibility, and potential integration with existing databases .

How does yihY compare structurally and functionally to other UPF0761 family members?

A comparative analysis of yihY within its protein family provides evolutionary and functional insights:

  • Sequence analysis reveals:

    • Highly conserved residues likely essential for function

    • Variable regions that may confer specificity

    • Predicted transmembrane topology shared among family members

  • Expression pattern comparison:

    • Conditions triggering expression across family members

    • Co-expression networks that suggest functional relationships

  • Phenotypic analysis:

    • Common phenotypes when different family members are deleted

    • Species-specific effects suggesting specialized functions

  • Evolutionary assessment:

    • Phylogenetic distribution across bacterial species

    • Evidence of horizontal gene transfer events

    • Selection pressure analysis (dN/dS ratios)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.