Recombinant Escherichia coli O45:K1 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Structure and Homology

ZntB is a zinc transport protein belonging to the CorA-MIT family . It shares homology with CorA magnesium transport proteins, which are widely distributed among eubacteria . ZntB consists largely of two independent domains, with the first 266 amino acids forming a large, highly charged domain within the membrane . Although there is no structural information for ZnT transporters, the structure of a bacterial homolog, YiiP, greatly contributes to the understanding of ZnT transporters . YiiP has six transmembrane (TM) helices with cytosolic NH2 and COOH termini and functions as a homodimer . TM helices I, II, IV, and V form the compact four-helix bundle where four conserved hydrophilic residues of TM helices II and V (three aspartic acids and one histidine, DD-HD) form an intramembranous zinc-binding site .

Transport Mechanism

ZntB mediates zinc transport across the cell membrane. Specifically, ZntB acts as a zinc:proton symporter, facilitating the uptake of zinc ions coupled with the movement of protons . This transport is stimulated by a pH gradient across the membrane . The zinc/proton (Zn2+/H+) exchange mechanism is conserved in ZnT transporters and involves an alternating access mechanism . In this mechanism, YiiP forms inward- and outward-facing conformations, both of which are able to bind Zn2+ or H+, and the extracellular proton provides a driving force for exporting Zn2+ from the cytosol .

Functional Studies and Research Findings

Research indicates that ZntB is involved in the transmembrane flux of zinc . Mutations in the zntB gene result in increased sensitivity to the cytotoxic effects of zinc, suggesting its role in zinc efflux . Transport assays have confirmed ZntB's capacity for zinc efflux, which can be complemented by a plasmid encoding a wild-type zntB allele .

Experiments show that ZntB most likely mediates Zn2+/H+ co-transport, indicating that ZntB is an importer for zinc . This confirms that the same fold within the CorA superfamily can be used either as a channel (CorA) or a transporter (ZntB) .

Role in Zinc Homeostasis and Virulence

ZntB is crucial for maintaining zinc homeostasis in Escherichia coli and other enteric bacteria . By mediating zinc transport, ZntB helps regulate intracellular zinc levels, preventing toxicity from excess zinc and ensuring an adequate supply for essential biological processes . Furthermore, ZntB has been linked to virulence in Enterobacteriaceae, highlighting its importance in bacterial pathogenesis .

Comparison to CorA Channels

ZntB and CorA proteins, though homologous, utilize different transport mechanisms . CorA functions primarily as a magnesium channel, while ZntB acts as a zinc importer . Structural comparisons indicate that ZntB's transport mechanism differs from that proposed for CorA channels .

Tables of Data

ProteinFunctionMetal SpecificityTransport Mechanism
ZntBZinc transporterZn2+Zn2+/H+ symport
CorAMagnesium channelMg2+Channel
YiiPZinc and cadmium transporterZn2+, Cd2+Zn2+/H+ exchange

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
zntB; ECS88_1485; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does ZntB differ from other zinc transporters in bacteria?

ZntB belongs to the CorA-MIT (Metal Ion Transporter) family but demonstrates unique transport characteristics that distinguish it from other zinc transporters and even from other members of its own family . Unlike CorA magnesium channels, ZntB does not collapse into a highly asymmetrical state upon depletion of divalent cations, suggesting a distinct transport mechanism .

ZntB also differs from other bacterial zinc transporters such as ZIPs (Zinc-Iron Permeases like ZupT) in its structural organization and transport kinetics . In the context of E. coli's zinc homeostasis system, ZntB works alongside other transporters like ZupT to maintain appropriate intracellular zinc concentrations through a controlled import-export balance .

What is the substrate specificity of ZntB?

Although ZntB primarily transports zinc ions, experimental evidence from transport assays with reconstituted liposomes demonstrates that it can also transport other divalent cations with varying efficiencies. Specifically:

Metal IonTransport ActivityDetection Method
Zn²⁺HighFluozin-1 dye
Ni²⁺Comparable to Zn²⁺Fluozin-1 dye
Cd²⁺Comparable to Zn²⁺Fluozin-1 dye
Co²⁺Not detectedFluozin-1 dye

The inability to detect Co²⁺ transport is likely due to the lower sensitivity of the fluozin-1 dye to this particular cation rather than an absolute inability of ZntB to transport cobalt .

What is the detailed transport mechanism of ZntB?

The transport mechanism of ZntB represents a significant departure from the previously proposed mechanisms based on its homolog CorA. Recent studies integrating cryo-electron microscopy, isothermal titration calorimetry, and transport assays with reconstituted liposomes have revealed that ZntB functions as a proton-driven zinc importer .

Key aspects of the ZntB transport mechanism include:

  • Proton Gradient Dependency: ZntB-mediated zinc transport is stimulated by a pH gradient across the membrane, suggesting a proton-coupled transport mechanism .

  • Conformational States: Unlike CorA, ZntB does not undergo collapse into an asymmetrical state upon depletion of divalent cations. Instead, it appears to utilize a symmetrical scaffold with subtle conformational changes to create a pathway for transported zinc ions .

  • Electrostatic Regulation: Dramatic differences in electrostatic surface potential between different states of ZntB suggest that charge inversions in the pore surface, possibly caused by helical rotation of TM1 (which contains conserved basic and acidic residues), play a crucial role in the transport cycle .

  • Binding Affinity: Isothermal titration calorimetry experiments have determined that ZntB binds zinc with a K<sub>M</sub> of approximately 7.5 μM, which is consistent with a transporter mechanism rather than a channel mechanism .

How do structural changes in ZntB correlate with its transport function?

The comparison between the full-length structure of ZntB from E. coli (EcZntB) and the soluble domain structure of ZntB from Salmonella typhimurium (StZntB) provides crucial insights into the structural basis of transport :

  • Surface Potential Differences: The cytoplasmic domain of full-length EcZntB (obtained in the absence of Zn²⁺) exhibits a strong positive electrostatic surface potential, whereas the isolated domain of StZntB (crystallized in the presence of Zn²⁺) shows a negative potential .

  • Pore Shape Alteration: The internal pore shape differs between the two forms, potentially representing two distinct conformational states in the transport cycle .

  • Helical Rotations: The charge inversion observed between the two symmetrical states may be facilitated by helical rotation of TM1, which contains highly conserved basic and acidic residues on adjacent faces .

These structural insights suggest that ZntB utilizes a unique transport mechanism that involves subtle conformational changes within a symmetrical scaffold, rather than the dramatic asymmetrical collapse seen in CorA channels .

What role does the pH gradient play in ZntB-mediated zinc transport?

The pH gradient across the membrane serves as a driving force for zinc transport by ZntB . Experimental evidence shows that ZntB-mediated Zn²⁺ uptake is stimulated by this pH gradient, indicating a proton-coupled transport mechanism .

This finding revolutionizes our understanding of ZntB function, as it was previously thought to be an exporter rather than an importer. The proton gradient dependency suggests that ZntB may utilize the energy stored in the proton motive force to drive zinc uptake against its concentration gradient .

The exact molecular mechanism by which the pH gradient facilitates zinc transport remains an active area of research, but it likely involves protonation/deprotonation events of key residues within the transport pathway that trigger conformational changes necessary for zinc translocation .

How can recombinant ZntB be expressed and purified for structural and functional studies?

Successful expression and purification of ZntB for structural and functional studies involves several critical steps:

  • Expression System: Recombinant full-length ZntB can be expressed in E. coli with an N-terminal His-tag for purification purposes .

  • Protein Extraction: As a membrane protein, ZntB requires detergent solubilization for extraction from the membrane. Appropriate detergents must be selected to maintain protein stability and function .

  • Purification Protocol:

    • Affinity chromatography using the His-tag

    • Size exclusion chromatography for further purification

    • Concentration to approximately 10 mg/ml for structural studies

  • Storage Considerations: Purified ZntB is typically stored in a buffer containing an appropriate detergent, with aliquoting recommended to avoid repeated freeze-thaw cycles. For long-term storage, addition of 5-50% glycerol (final concentration) and storage at -20°C/-80°C is recommended .

  • Reconstitution: For functional studies, purified ZntB should be reconstituted into liposomes using established protocols to assess transport activity .

What techniques are used to determine the structure of ZntB?

The structural characterization of ZntB has employed several complementary techniques:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Sample preparation: ZntB at ~10 mg/ml applied to holey carbon grids, blotted for 4-5 seconds, and plunge-frozen in liquid ethane

    • Imaging: 300 keV microscope (Titan Krios) equipped with a K2 direct-electron detector

    • Data collection: 2,655 movie images collected with 24 frames dose-fractionated over 18 seconds in super-resolution counting mode

    • Motion correction using MOTIONCORR 1.0

  • X-ray Crystallography: Used primarily for the soluble domain of ZntB from Salmonella typhimurium (StZntB) .

  • Computational Methods:

    • Surface potential calculations to reveal electrostatic differences between conformational states

    • Threading of sequences to generate comparative models

    • Density functional theory (DFT) for theoretical validation of structural observations

These approaches have collectively provided insights into the full-length structure of ZntB and its conformational states relevant to the transport mechanism .

How can zinc transport activity be measured in reconstituted ZntB?

Zinc transport by reconstituted ZntB can be measured using several complementary approaches:

  • Fluorescent Dye Assays:

    • Reconstitution of purified ZntB into liposomes

    • Encapsulation of zinc-sensitive fluorescent dyes (e.g., Fluozin-1) within liposomes

    • Monitoring fluorescence changes upon addition of zinc to the external medium

    • This approach allows for real-time monitoring of transport and can also be adapted to test other divalent cations

  • Radioligand Uptake Assays:

    • Using radioactive zinc isotopes (e.g., ⁶⁵Zn) to directly measure transport into liposomes

    • Provides quantitative measurement of transport rates and substrate specificity

  • Isothermal Titration Calorimetry (ITC):

    • While not a direct transport assay, ITC provides valuable information on binding affinities

    • ZntB has been shown to bind zinc with a K<sub>M</sub> of approximately 7.5 μM

    • Can be used to test binding of various potential substrates to distinguish between transported and non-transported metals

These methodologies collectively provide a comprehensive assessment of ZntB transport activity, specificity, and mechanism .

What insights have cryo-EM studies provided about ZntB structure?

Cryo-electron microscopy has revealed the full-length structure of ZntB from E. coli, providing several key insights:

These structural insights have been crucial for understanding the unique transport mechanism of ZntB and distinguishing it from other members of the CorA-MIT family .

How does the molecular mechanism of ZntB compare to other transport proteins?

ZntB employs a transport mechanism that is distinct from both its homologue CorA and other zinc transporters:

This unique transport mechanism makes ZntB an interesting model system for understanding proton-coupled metal transport across biological membranes .

What is the significance of ZntB in bacterial zinc homeostasis and virulence?

ZntB plays a crucial role in bacterial zinc homeostasis, which is particularly important in the context of host-pathogen interactions:

  • Zinc Homeostasis: As a zinc importer, ZntB contributes to maintaining appropriate intracellular zinc concentrations, which is essential for bacterial survival and function .

  • Host-Pathogen Interface: Zinc availability is a critical factor in host-pathogen dynamics:

    • Host organisms often attempt to sequester zinc at the host-pathogen interface to reduce bacterial virulence

    • Conversely, hosts may elevate zinc concentrations to toxic levels to combat pathogens

    • Bacterial zinc transporters like ZntB help pathogens navigate these challenges

  • Virulence Connection: In Enterobacteriaceae, several membrane transporters involved in zinc homeostasis are linked to virulence . While ZntB's specific contribution to virulence has not been fully characterized, its role in zinc homeostasis suggests it may contribute to bacterial survival in the host environment.

  • Potential Therapeutic Target: Understanding ZntB structure and function opens possibilities for developing inhibitors that could disrupt bacterial zinc homeostasis and potentially reduce virulence .

These insights highlight the importance of ZntB in bacterial physiology and pathogenesis, particularly in the complex dynamics of metal homeostasis during infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.