Recombinant Escherichia coli O45:K1 Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

ZupT is a broad-spectrum divalent metal transporter with the following roles:

  • Primary Substrates: Zn²⁺, Fe²⁺, Co²⁺, and Mn²⁺ .

  • Transport Mechanism: Chemiosmotic gradient-driven uptake (non-ATP dependent) .

  • Regulation: Constitutively expressed at low levels, independent of metal availability .

Functional Comparison with Other Transporters

TransporterFamilySubstratesEnergy SourceRole in E. coli
ZupTZIPZn²⁺, Fe²⁺, Co²⁺Proton gradientBackup zinc uptake
ZnuACBABC-typeZn²⁺ (high affinity)ATP hydrolysisPrimary zinc uptake
SitABCDABC-typeMn²⁺/Fe²⁺ATP hydrolysisManganese/iron uptake

In zinc-limited conditions, ZupT compensates for the loss of ZnuACB but is less efficient due to lower substrate affinity .

Key Uses in Scientific Studies

  1. Metal Homeostasis Studies: Used to elucidate zinc uptake mechanisms in pathogenic E. coli strains .

  2. Pathogenesis Models: Knockout studies in UPEC strain CFT073 revealed reduced virulence in murine urinary tract infections (UTIs), linked to impaired oxidative stress resistance and motility .

  3. Biochemical Assays:

    • 65Zn²⁺ Uptake Assays: Demonstrated ZupT-mediated transport rates comparable to Feo and MntH systems .

    • Metal Sensitivity Tests: Overexpression causes hypersensitivity to Zn²⁺ and Co²⁺ .

Critical Insights from Studies

  1. Zinc Transport Redundancy:

    • ΔzupT mutants show no growth defects unless combined with ΔznuACB, indicating functional overlap .

    • ZupT restores growth in iron-deficient E. coli strains, highlighting its role in Fe²⁺ uptake .

  2. Pathogenic Role:

    • In UPEC CFT073, ΔznuACB ΔzupT mutants exhibit 30–48-fold reduced colonization in mouse bladders/kidneys .

    • Zinc supplementation rescues motility and oxidative stress resistance in mutants .

  3. Substrate Competition:

    • Cd²⁺ inhibits ZupT-mediated Zn²⁺ uptake, while Cu²⁺ causes mild toxicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
zupT; ECS88_3437; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli O45:K1 (strain S88 / ExPEC)
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Uniprot No.

Target Background

Function
ZupT, the Zinc transporter from Escherichia coli O45:K1, mediates zinc uptake. It may also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZupT and what is its role in E. coli?

ZupT is a zinc uptake transporter in Escherichia coli that belongs to the ZIP (Zrt-/Irt-like Protein) family of transporters. This protein represents the first bacterial member of the ZIP family and plays a crucial role in zinc homeostasis . The protein is encoded by the zupT gene (formerly designated as ygiE) and consists of 257 amino acids in E. coli O45:K1 . ZupT functions during zinc-sufficient conditions, complementing the high-affinity ZnuACB system that operates under zinc limitation . Research has revealed that ZupT functions as a broad-range metal ion transporter, primarily facilitating zinc uptake while also potentially transporting other divalent cations including iron, cadmium, and copper .

How does the structure of ZupT relate to its metal transport function?

ZupT contains an asymmetric binuclear metal center in its transmembrane domain with two distinct metal-binding sites: M1 and M2. These sites exhibit differential metal-binding properties, with M1 binding zinc, cadmium, and iron, while M2 binds iron only and with higher affinity than M1 . The two sites share a common bridging ligand - a conserved glutamate residue. Both M1 and M2 sites have ligands derived from highly conserved motifs in transmembrane domains 4 and 5 . Additionally, M2 has a ligand from transmembrane domain 6, a glutamate residue that is conserved in the gufA subfamily of ZIP transporters, including ZupT and human ZIP11 . This structural arrangement enables ZupT to transport different essential metals without competition - zinc is transported from M1, while iron is transported from M2 .

What distinguishes ZupT from other zinc transport systems in E. coli?

E. coli employs multiple zinc transport systems, with ZupT and ZnuACB being the primary zinc uptake mechanisms. Key differences include:

FeatureZupTZnuACB
FamilyZIP familyABC transporter family
AffinityLower affinityHigher affinity
ConditionsFunctions in zinc-sufficient conditionsPredominant in zinc-limited conditions
Metal specificityBroader (Zn, Fe, possibly Cd and Cu)More specific for zinc
Impact of deletionLess growth inhibition with EDTAMore growth inhibition with EDTA

Studies have demonstrated that ZnuABC appears to have a higher affinity for zinc than ZupT, as strains with zupT deletion show less growth inhibition by high EDTA concentrations compared to znuABC deletion strains . While ZnuACB is the predominant zinc transporter, ZupT plays a complementary role, and the loss of both systems has a cumulative effect on bacterial fitness .

How can researchers express and purify recombinant ZupT protein?

For successful expression and purification of recombinant ZupT, researchers can follow this methodological approach:

  • Expression system: Use E. coli as an expression host for the full-length ZupT protein (amino acids 1-257) fused to an N-terminal His-tag .

  • Purification protocol:

    • Lyse cells and purify using affinity chromatography

    • Verify purity (>90%) by SDS-PAGE analysis

    • Prepare as lyophilized powder for storage

  • Storage and handling:

    • Store at -20°C/-80°C upon receipt

    • For reconstitution, briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

What methods are effective for studying zinc uptake mediated by ZupT?

Several complementary approaches can be used to investigate ZupT-mediated zinc transport:

  • Radioactive tracer experiments: Use 65Zn2+ to directly measure transport activity. This approach has been successfully employed in studies where cells expressing ZupT from a plasmid exhibited increased uptake of 65Zn2+ .

  • Genetic approaches: Create clean genetic backgrounds by disrupting other zinc transport systems (znuABC, zntA, zitB, zntB) to isolate ZupT activity. For example, E. coli GR362 (zntA::kan ΔzitB ΔzupT ΔznuABC ΔzntB::cam) has been used as a background strain for ZupT expression studies .

  • Growth assays: Monitor bacterial growth in media containing zinc chelators like EDTA, with or without zinc supplementation. Strains with disruptions in both zupT and znuABC show inhibited growth at lower EDTA concentrations compared to single mutants or wild-type strains .

  • Metal competition studies: Examine the effects of different metals on ZupT activity. For instance, cadmium appears to antagonize zinc effects in zupT-overexpressing strains, suggesting competition for binding sites .

How can researchers investigate the metal-binding properties of the ZupT binuclear center?

To characterize the unique binuclear metal center of ZupT, researchers can employ:

  • Site-directed mutagenesis: Target conserved residues in the metal-binding sites, particularly:

    • The bridging glutamate that connects M1 and M2

    • Ligands from conserved motifs in transmembrane domains 4 and 5

    • The glutamate in transmembrane domain 6 that serves as an M2 ligand

  • Transport activity measurements: Assess the functional consequences of mutations using:

    • Whole-cell transport assays with 65Zn2+

    • Reconstituted proteoliposomes for in vitro transport studies

  • Metal specificity determination: Evaluate how different metals (zinc, iron, cadmium) interact with wild-type and mutant ZupT proteins. Research has shown that iron transport from M2 does not inhibit zinc transport from M1 but slightly stimulates it through the bridging carboxylate ligand .

How does ZupT contribute to bacterial metal homeostasis networks?

ZupT functions within a complex network of metal transport systems in E. coli:

  • Complementary zinc uptake systems: While ZnuACB is the predominant high-affinity zinc transporter operating under zinc limitation, ZupT provides a complementary uptake mechanism, particularly under zinc-sufficient conditions .

  • Multi-metal transport capability: ZupT's ability to transport zinc, iron, and potentially other divalent cations allows it to contribute to the homeostasis of multiple essential metals simultaneously .

  • Interaction with efflux systems: ZupT functions alongside zinc efflux systems like ZntA and ZitB. Studies have shown that expression of zupT in E. coli GG48 (zntA::kan ΔzitB::cam) leads to reduced viability even in standard Luria-Bertani broth without added zinc, due to zinc accumulation from residual zinc in the medium .

  • Physiological consequences: The metal transport capability of ZupT affects multiple cellular processes. Loss of zinc transport systems including ZupT has been shown to decrease both bacterial motility and resistance to hydrogen peroxide, which can be restored by zinc supplementation .

What is the significance of the asymmetric binuclear metal center in ZupT?

The asymmetric binuclear center in ZupT represents a sophisticated evolutionary adaptation:

  • Specialized transport mechanisms: The binuclear center enables ZupT to transport essential metals from two different sites without competition - zinc from M1 and iron from M2 .

  • Cooperative metal transport: Unlike cadmium, which inhibits zinc transport when it binds to M1, iron binding to M2 actually stimulates zinc transport activity. This stimulation is mediated through the bridging carboxylate ligand that connects the two metal sites .

  • Evolutionary significance: This binuclear zinc-iron binding center has likely evolved to optimize the transport of multiple essential metals simultaneously. A similar mechanism of metal transport is likely to be found in other members of the gufA subfamily of ZIP transporter proteins, including the human ZIP11 .

  • Structural insights: The M1 and M2 sites derive ligands from highly conserved motifs in transmembrane domains 4 and 5, with M2 having an additional ligand from transmembrane domain 6 that is specifically conserved in the gufA subfamily .

How does ZupT function impact bacterial pathogenesis?

ZupT contributes to bacterial pathogenesis in several ways:

  • Urinary tract infection models: Studies using uropathogenic E. coli (UPEC) CFT073 in a murine ascending UTI model have shown that:

    • ZupT deletion alone does not significantly impact colonization

    • Combined ZnuACB and ZupT deletion significantly reduces bacterial numbers in both bladders (mean 30-fold reduction) and kidneys (mean 48-fold reduction)

    • Complementation with znuACB genes restores bacterial numbers in the urinary tract

  • Virulence-associated phenotypes: Loss of zinc transport systems affects key virulence determinants:

    • Decreased motility, which is important for ascending infection

    • Reduced resistance to hydrogen peroxide, affecting survival against host immune defenses

    • These deficits can be reversed by zinc supplementation

  • Metal acquisition during infection: While ZupT is not the primary zinc acquisition system during infection (ZnuACB plays this dominant role), it provides an important complementary mechanism for zinc uptake in the host environment .

What are common challenges when working with recombinant ZupT and how can they be addressed?

Researchers working with recombinant ZupT may encounter several challenges:

  • Protein stability issues: As a membrane protein, ZupT can be unstable during purification and storage.

    • Solution: Add 5-50% glycerol for long-term storage

    • Store at -20°C/-80°C and avoid repeated freeze-thaw cycles

    • Use working aliquots at 4°C for no more than one week

  • Expression level variability: Membrane protein expression can be inconsistent.

    • Solution: Use controlled induction systems like anhydrotetracycline (AHT)

    • Monitor expression levels carefully, as overexpression of ZupT can lead to zinc hypersensitivity in cells lacking zinc efflux systems

  • Metal contamination: Background levels of zinc in media can confound experiments.

    • Solution: Use chelators like EDTA to control metal availability

    • Be aware that even standard LB broth contains residual zinc that can affect ZupT-overexpressing strains

How can researchers differentiate between zinc and iron transport by ZupT?

Distinguishing between zinc and iron transport mediated by ZupT requires specialized approaches:

  • Metal-specific tracers: Use 65Zn2+ and radioactive iron isotopes to track the transport of each metal specifically.

  • Site-directed mutagenesis: Target residues specific to each metal-binding site:

    • Mutations affecting M1 should primarily impact zinc transport

    • Mutations affecting M2 should primarily impact iron transport

    • Mutations affecting the bridging glutamate may impact both

  • Metal competition assays: Examine how the presence of one metal affects the transport of another:

    • Iron binding to M2 slightly stimulates zinc transport

    • Cadmium binding to M1 inhibits zinc transport

  • Phenotypic assessment: Monitor phenotypes associated with zinc or iron deficiency in mutant strains under different metal supplementation conditions.

What are emerging approaches for studying ZupT structure-function relationships?

Several cutting-edge approaches show promise for advancing our understanding of ZupT:

How might understanding ZupT function contribute to antimicrobial development?

The essential role of zinc acquisition in bacterial pathogenesis suggests several potential therapeutic approaches:

  • Targeted inhibition: Developing compounds that specifically inhibit ZupT and other zinc transport systems could reduce bacterial fitness during infection.

  • Metal chelation strategies: Combining specific zinc chelators with antibiotics might enhance efficacy against pathogens reliant on zinc uptake.

  • Exploitation of metal toxicity: Using the knowledge that ZupT can transport toxic metals like cadmium to develop metal-based antimicrobials.

  • Vaccine development: The external portions of metal transporters like ZupT could potentially serve as vaccine targets.

  • Host defense enhancement: Strategies to bolster host nutritional immunity mechanisms that restrict zinc availability to pathogens.

Given that combined deletion of ZupT and ZnuACB significantly reduces fitness of uropathogenic E. coli during urinary tract infection , targeting these systems represents a promising approach for new antimicrobial strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.