Recombinant Escherichia coli O6:K15:H31 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiA; ECP_4257; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function

This recombinant Escherichia coli O6:K15:H31 4-hydroxybenzoate octaprenyltransferase (UbiA) catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the initial membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.

Database Links

KEGG: ecp:ECP_4257

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of 4-hydroxybenzoate octaprenyltransferase (ubiA) in E. coli?

4-hydroxybenzoate octaprenyltransferase, encoded by the ubiA gene, is a key enzyme in the ubiquinone biosynthesis pathway of E. coli. This enzyme catalyzes the transfer of an octaprenyl group to 4-hydroxybenzoate, forming 3-octaprenyl-4-hydroxybenzoate. This reaction represents a critical step in the production of ubiquinone, an essential component of the electron transport chain involved in aerobic respiration. The enzyme enables E. coli to synthesize ubiquinone, which is necessary for growth under aerobic conditions. Mutants lacking functional ubiA show a respiration-defective phenotype, highlighting the crucial role of this enzyme in cellular energy metabolism .

Where is the ubiA gene located on the E. coli chromosome?

Genetic analysis has mapped the ubiA gene to minute 79 on the E. coli chromosome . This positional information is important for researchers conducting genetic manipulation experiments or analyzing gene organization in E. coli. The chromosomal location can influence gene expression patterns and genetic linkage with other genes. Researchers studying E. coli strain 536 (O6:K15:H31) should note that while the strain contains multiple pathogenicity islands (PAIs), the ubiA gene is part of the core genome rather than being located on one of these mobile genetic elements .

What is the molecular weight of the ubiA protein product?

Studies involving the overexpression of the ubiA gene have determined that the molecular mass of the protein product is 32 kDa . This information is essential for researchers conducting protein purification, Western blot analysis, or other protein-based experiments involving ubiA. The relatively moderate size of this protein makes it amenable to various protein expression systems and purification strategies. Researchers should consider this molecular weight when designing experimental protocols such as SDS-PAGE analysis or size exclusion chromatography for ubiA protein characterization.

How is ubiA gene expression regulated in E. coli?

The expression of the ubiA gene in E. coli is subject to complex regulatory mechanisms. Studies using ubiA-lacZ fusion systems have demonstrated that ubiA expression is catabolite-repressed by glucose . This repression mechanism is particularly evident in arcA mutant strains. ArcA functions as a positively acting transcriptional regulator of oxygen-regulated genes in E. coli, suggesting that ubiA expression is linked to the cell's oxygen status and energy metabolism .

This regulatory pattern is consistent with ubiA's role in ubiquinone biosynthesis, as ubiquinone is primarily needed during aerobic respiration. Researchers working with recombinant E. coli expressing ubiA should consider these regulatory factors when designing expression systems. For optimal expression of recombinant ubiA, media composition (particularly glucose concentration) and oxygen availability should be carefully controlled. Growth conditions that minimize catabolite repression might yield higher expression levels of the target protein.

What are the biochemical properties of the 4-hydroxybenzoate octaprenyltransferase enzyme?

The 4-hydroxybenzoate octaprenyltransferase enzyme has several distinct biochemical properties that influence its function and experimental handling. The enzyme is membrane-bound, which has implications for its isolation and characterization . For optimal activity, the enzyme requires Mg²⁺ as a cofactor . This divalent cation requirement is important to consider when designing in vitro enzyme assays or when attempting to express and purify active enzyme.

The substrate specificity of the enzyme appears to be relatively broad, as evidenced by cross-species complementation experiments. The respiration-defective phenotype of ubiA mutants can be complemented by expression of the COQ2 gene from Saccharomyces cerevisiae, which encodes 4-hydroxybenzoate hexaprenyl transferase . This successful complementation demonstrates that despite differences in the prenyl chain length (octaprenyl in E. coli versus hexaprenyl in yeast), the yeast enzyme can functionally substitute for the bacterial enzyme, suggesting flexibility in substrate recognition.

What phenotypes are associated with ubiA mutations in E. coli?

E. coli strains carrying mutations in the ubiA gene exhibit specific phenotypes that can be used for genetic selection and screening. The most prominent phenotype is a respiration defect due to the inability to synthesize ubiquinone . This results in impaired growth under aerobic conditions, particularly when the bacteria are forced to rely on respiration rather than fermentation for energy production.

Strains with disrupted ubiA genes, constructed by chromosomal gene replacement with antibiotic resistance markers such as the chloramphenicol resistance gene, show these characteristic growth deficiencies . The respiration-defective phenotype can be complemented by expression of either the native ubiA gene or functional homologs like the yeast COQ2 gene, restoring ubiquinone production and normal respiratory growth . These phenotypic characteristics make ubiA mutations useful tools for studying ubiquinone biosynthesis and for developing selection systems in genetic engineering applications.

How can researchers create and validate ubiA mutants in E. coli?

Creating ubiA mutants requires precise genetic manipulation techniques. Based on established protocols for E. coli 536, several effective approaches can be employed:

  • Chromosomal Gene Replacement: Researchers can construct strains with disrupted ubiA by replacing the chromosomal gene with an antibiotic resistance marker, such as the chloramphenicol resistance gene . This technique involves amplifying the resistance gene with primers containing homology regions flanking the ubiA gene, followed by transformation and selection on appropriate antibiotic media.

  • One-Step Gene Inactivation: Similar to the approach used for creating recA mutants in E. coli 536, researchers can use the one-step chromosomal gene inactivation technique developed by Datsenko and Wanner . This method involves electroporation of a PCR product containing an antibiotic resistance cassette flanked by homology regions into cells expressing the λ Red recombinase system.

Validation of successful ubiA mutation can be performed through:

  • Phenotypic Testing: Screening for the respiration-defective phenotype characteristic of ubiA mutants, including impaired growth under aerobic conditions .

  • PCR Verification: Using primers flanking the ubiA locus to confirm the presence of the antibiotic resistance cassette and absence of the native gene .

  • Complementation Studies: Transforming suspected mutants with plasmids expressing functional ubiA or homologs like COQ2 to restore ubiquinone production and normal respiratory growth .

What methods can be used to express and purify recombinant ubiA protein?

Expressing and purifying recombinant ubiA protein presents specific challenges due to its membrane-associated nature. Based on experimental approaches described in the literature, the following methods are recommended:

  • Expression Systems: For overexpression of ubiA, researchers have successfully used E. coli expression systems . When designing expression vectors, consider using inducible promoters that are not subject to glucose catabolite repression, given the known regulatory patterns of ubiA.

  • Membrane Protein Extraction: Since ubiA is membrane-bound , standard protein extraction protocols need to be modified to include detergent-based membrane solubilization steps. Commonly used detergents include n-dodecyl-β-D-maltoside (DDM), Triton X-100, or CHAPS.

  • Purification Strategy: Affinity chromatography using tagged recombinant ubiA (His-tag or other affinity tags) followed by size exclusion chromatography is a viable purification approach. Remember to include Mg²⁺ in all buffers to maintain enzyme stability and activity .

  • Activity Assays: Purified enzyme can be assayed for activity by measuring the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate. HPLC or LC-MS methods can be employed to detect the reaction products.

How can researchers transform E. coli strain 536 (O6:K15:H31) for ubiA studies?

E. coli strain 536 (O6:K15:H31) requires specific transformation protocols due to its uropathogenic nature. Based on methods described for this strain, researchers should follow these approaches:

  • Electroporation Protocol: The most effective method for transforming E. coli 536 is electroporation. Cells should be grown to mid-log phase, washed repeatedly with ice-cold water, and resuspended in 10% (vol/vol) glycerol to a cell density of approximately 3 × 10¹⁰ cells ml⁻¹. Electroporation should be performed at 2.5 kV, 25 μF, and 600 Ω in 2-mm-gap electroporation cuvettes .

  • Plasmid Construction: When creating vectors for ubiA expression or manipulation in E. coli 536, care should be taken to ensure compatibility with this strain. Plasmids with origins of replication that function in pathogenic E. coli strains should be selected.

  • Selection Markers: Appropriate antibiotic resistance markers should be used for selection. The literature describes successful use of ampicillin, chloramphenicol, and tetracycline resistance genes in E. coli 536 .

  • Verification Methods: Successful transformants can be verified through PCR, phenotypic testing, or expression analysis depending on the specific genetic modification being introduced.

How does ubiA function differ between commensal and pathogenic E. coli strains?

This advanced research question explores the potential differences in ubiA function between commensal E. coli strains and pathogenic strains like E. coli 536 (O6:K15:H31). While the primary enzymatic function of ubiA in ubiquinone biosynthesis remains consistent across strains, several aspects warrant investigation:

  • Expression Patterns: Pathogenic strains may exhibit different regulatory patterns of ubiA expression in response to host environments. Researchers should design comparative transcriptomic studies examining ubiA expression under various conditions mimicking host environments (urinary tract, bloodstream, etc.) between pathogenic and commensal strains.

  • Metabolic Integration: The integration of ubiquinone biosynthesis with virulence factor expression in pathogenic strains represents an intriguing research avenue. E. coli 536, with its multiple pathogenicity islands , offers an excellent model for studying how core metabolic processes interact with virulence mechanisms.

  • Structural Variations: Comparative protein structure analysis between ubiA from different strains might reveal subtle amino acid variations that influence enzyme efficiency or regulation, potentially contributing to pathogenic fitness in specific niches.

Methodologically, researchers could approach this question through comparative genomics, transcriptomics, and biochemical characterization of ubiA from multiple strains, coupled with virulence studies in appropriate model systems.

What is the potential of small molecule inhibitors targeting ubiA as antimicrobial agents?

The search results mention that DHB, a small molecule produced by Photorhabdus, interferes with ubiquinone biosynthesis by binding to UbiA and preventing downstream reactions . This observation opens an important research direction for antimicrobial development:

  • Structure-Activity Relationship Studies: Researchers should investigate the structural features of DHB and related compounds that confer UbiA-binding capability. This requires computational modeling of UbiA-inhibitor interactions, synthesis of chemical analogs, and in vitro binding assays.

  • Specificity Assessment: Determining whether inhibitors can selectively target bacterial UbiA without affecting mammalian homologs is crucial for developing safe antimicrobials. Comparative inhibition studies using both bacterial and mammalian enzymes would address this question.

  • Resistance Development: Investigating the potential for resistance development against UbiA inhibitors through mechanisms such as enzyme mutation, upregulation, or metabolic bypassing would provide valuable insights into the long-term utility of such compounds.

  • Combination Therapies: Testing UbiA inhibitors in combination with existing antibiotics could reveal synergistic effects, particularly against uropathogenic E. coli strains like 536 (O6:K15:H31).

Methodologically, this research would combine medicinal chemistry approaches with microbiology techniques including minimum inhibitory concentration (MIC) determinations, time-kill studies, and in vivo infection models.

How can functional homology between bacterial ubiA and eukaryotic prenyl transferases be exploited for biotechnological applications?

The functional complementation of E. coli ubiA mutants by the yeast COQ2 gene demonstrates cross-kingdom functional conservation of prenyl transferases, opening several research avenues:

  • Enzyme Engineering: The structural and functional similarities between bacterial UbiA and eukaryotic prenyl transferases can be exploited for enzyme engineering. Researchers could create chimeric enzymes combining bacterial and eukaryotic domains to develop biocatalysts with novel substrate specificities or improved catalytic properties.

  • Heterologous Production Systems: The ability of yeast COQ2 to function in E. coli suggests that heterologous expression systems could be developed for producing diverse prenylated compounds of biotechnological interest, such as modified ubiquinones or other prenylated secondary metabolites.

  • Evolutionary Studies: Comparative analysis of bacterial UbiA and eukaryotic prenyl transferases can provide insights into the evolution of these enzymes and their substrate specificity determinants. This knowledge could guide rational design approaches for creating enzymes with desired properties.

Methodologically, this research would involve protein structure determination, site-directed mutagenesis, heterologous expression, and enzyme kinetics studies to characterize natural and engineered variants of prenyl transferases from different organisms.

What are the key considerations for designing ubiA expression constructs?

When designing expression constructs for ubiA, researchers should consider several factors to maximize expression and functionality:

  • Promoter Selection: Given that ubiA expression is catabolite-repressed by glucose , selecting promoters that are not subject to this regulation is crucial. Common options include:

    • T7 promoter system for high-level expression in specialized E. coli strains

    • Arabinose-inducible promoters (PBAD) for titratable expression

    • Constitutive promoters with varying strengths for consistent expression

  • Codon Optimization: Optimizing the ubiA coding sequence for the expression host can improve translation efficiency. This is particularly important when expressing ubiA in heterologous hosts.

  • Fusion Tags: Consider incorporating purification and solubility enhancement tags:

    • N-terminal or C-terminal His6 tags for affinity purification

    • MBP (maltose-binding protein) or SUMO tags to enhance solubility of the membrane-associated enzyme

    • Inclusion of TEV or other protease cleavage sites for tag removal

  • Signal Sequences: Since UbiA is naturally membrane-bound , appropriate signal sequences or membrane-targeting domains should be maintained or incorporated to ensure proper localization.

  • Vector Backbone: Selection of appropriate vector backbones compatible with the target strain is essential. For E. coli 536 (O6:K15:H31), vectors with compatible origins of replication and appropriate selection markers should be chosen .

What methods can be used to assess the enzymatic activity of recombinant ubiA?

Assessing the enzymatic activity of recombinant ubiA requires specialized techniques due to its membrane association and the nature of its substrates and products:

  • In vitro Enzymatic Assays:

    • Reaction mixture should contain purified ubiA protein, 4-hydroxybenzoate substrate, octaprenyl diphosphate co-substrate, and Mg²⁺ co-factor

    • Detergent micelles or lipid vesicles may be required to maintain enzyme activity

    • Products can be analyzed by HPLC, LC-MS, or radioactive substrate incorporation

  • Complementation Assays:

    • Expression of recombinant ubiA in ubiA-deficient strains should restore ubiquinone production and aerobic growth

    • This approach provides a functional readout of enzymatic activity in vivo

    • Similar to the complementation observed with the yeast COQ2 gene

  • Ubiquinone Quantification:

    • Extraction of cellular lipids followed by HPLC or LC-MS analysis

    • Comparison of ubiquinone levels between wild-type, ubiA-deficient, and complemented strains

    • This approach directly measures the end product of the pathway involving ubiA

  • Inhibition Studies:

    • Using known inhibitors like DHB to validate the enzymatic activity

    • Dose-response studies with inhibitors can provide insights into enzyme kinetics

    • Competition assays with substrate analogs can reveal binding site characteristics

What genetic and molecular tools are available for manipulating ubiA in E. coli strain 536?

E. coli strain 536 (O6:K15:H31) has been used as a model organism for genetic manipulation studies, and several tools and techniques applicable to ubiA research have been described:

  • Chromosomal Gene Replacement:

    • The island-probing approach described for studying pathogenicity islands can be adapted for ubiA manipulation

    • Counterselectable markers like sacB can be used for selection of recombination events

    • This approach allows precise manipulation of the chromosomal ubiA locus

  • One-Step Gene Inactivation:

    • The protocol described by Datsenko and Wanner has been successfully applied to E. coli 536

    • This involves PCR amplification of antibiotic resistance cassettes with homology extensions, followed by λ Red recombinase-mediated recombination

    • The technique allows for marker-less gene deletions when combined with FLP recombinase for marker removal

  • Allelic Exchange Vectors:

    • Suicide vectors like pGP704 derivatives have been used in E. coli 536

    • These vectors can be engineered to carry modified ubiA alleles for introducing specific mutations

    • Selection for double-crossover events can be achieved using counterselectable markers

  • Complementation Systems:

    • Plasmid-based expression systems for complementation studies

    • Integration of complementing genes at neutral sites like the λ attachment site (attB λ)

    • These systems allow for testing the functionality of modified ubiA alleles or homologs

Table 1: Key Genetic Tools for Manipulating ubiA in E. coli 536

TechniqueApplicationAdvantagesConsiderations
λ Red RecombineeringGene deletions, insertionsFast, efficient, minimal scarRequires transformation with pKD46 plasmid
Suicide Vector IntegrationAllelic exchangePrecise mutations possibleRequires multiple selection steps
attB λ IntegrationStable complementationSingle-copy, stableLimited to one insertion per attachment site
Plasmid ComplementationFunctional analysisMultiple copy, high expressionPlasmid instability without selection
sacB CounterselectionMarker-less mutationsClean genetic backgroundSpontaneous sacB mutations can occur

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.