Recombinant Escherichia coli O6:K15:H31 ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant atpF subunit is overexpressed in E. coli strains (e.g., C41(DE3) or C43(DE3)) and purified via affinity chromatography (His-tag) . Key production parameters include:

ParameterDetails
Expression HostE. coli (e.g., C43(DE3)) for high-yield intracellular membrane formation
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol recommended

Overproduction in E. coli induces intracellular membrane proliferation, facilitating easy recovery of the protein without inclusion body formation .

Functional and Binding Properties

The b subunit dimer binds tightly to the F₁ sector, with a dissociation constant (Kd) of 0.2 nM for the F₁b₂ complex . Key interactions include:

  • Crosslinking Sites: Residues interacting with subunits a, α, β, and δ

  • Mechanistic Role:

    • Serves as a stator during proton-driven rotation of the F₀F₁ complex

    • Directly influences catalytic site activity through δ subunit interactions

Pathogenicity Context

The O6:K15:H31 strain’s PAI V536 encodes the K15 capsule determinant, enhancing virulence . Subunit b’s recombinant form may aid in studying ATP synthase function in pathogenic E. coli strains.

Handling and Stability

RecommendationDetails
Storage-20°C/-80°C in aliquots with 50% glycerol
AvoidRepeated freeze-thaw cycles; store working aliquots at 4°C for <1 week
ReconstitutionCentrifuge vials before opening; use sterile water to prevent aggregation

Comparison with Non-Recombinant Forms

FeatureRecombinant atpFNative atpF
TagN-terminal His-tag Untagged
Purity>90% (via affinity chromatography) Membrane-associated
ApplicationsStructural studies, binding assays Limited due to membrane association

Future Directions

  • Therapeutic Targets: Study of atpF’s role in pathogenic E. coli ATP synthase for antibiotic development.

  • Biotechnological Uses: Engineering subunit b for enhanced proton translocation efficiency in biofuel production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; ECP_3935; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled, through a rotary mechanism involving the central stalk subunits, to proton translocation. This subunit is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).
Database Links

KEGG: ecp:ECP_3935

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in E. coli metabolism?

ATP synthase subunit b functions as a critical structural component of the F₀ domain within the F₁F₀ ATP synthase complex. This peripheral stalk component provides stability to the entire complex and serves as a physical connection between the membrane-embedded proton channel and other subunits. The peripheral stalk is crucial for maintaining the stability of the c-ring/F₁ complex, as demonstrated in various assembly studies . The subunit b helps to anchor the catalytic F₁ portion to the membrane-integrated F₀ portion, enabling the efficient conversion of the proton gradient energy into ATP synthesis.

What are the structural characteristics of ATP synthase subunit b from E. coli O6:K15:H31?

The ATP synthase subunit b from E. coli O6:K15:H31 contains:

  • A hydrophobic N-terminal domain that anchors the protein in the membrane

  • An extended α-helical domain that forms part of the peripheral stalk

  • A C-terminal domain that interacts with the F₁ portion of the complex

Structurally, the subunit exists as a dimer within the complex and provides crucial stability to the entire ATP synthase assembly. The dimeric nature of subunit b contributes significantly to maintaining the integrity of the F₁F₀ complex during the rotational catalysis process .

How does ATP synthase assembly occur in E. coli?

ATP synthase assembly in E. coli follows a modular pathway similar to that observed in yeast studies. The assembly process includes:

  • Formation of the c-ring

  • Binding of the F₁ catalytic domain

  • Attachment of the stator arm (including subunit b)

  • Final addition of subunits a and A6L

Research indicates that ATP synthase assembly involves two separate pathways that converge at the final stage. The peripheral stalk, which includes subunit b, is critical for stabilizing the c-ring/F₁ complex during assembly . This assembly process allows for a balanced output between nuclear-encoded and mtDNA-encoded subunits in eukaryotic systems, while in prokaryotes like E. coli, the assembly follows similar principles but with all components encoded in the bacterial genome.

What experimental controls are essential when working with recombinant ATP synthase subunit b?

When working with recombinant ATP synthase subunit b, essential experimental controls include:

  • Expression controls: Comparison with wild-type E. coli strain to verify expression levels and patterns

  • Structural integrity controls: Analysis of proper folding and dimerization using size exclusion chromatography

  • Functional controls: ATP hydrolysis and synthesis assays with reconstituted complexes

  • Negative controls: Experiments with inactive mutants or in the absence of critical cofactors

  • Strain-specific controls: Comparison with non-pathogenic E. coli strains to identify serotype-specific characteristics

These controls help ensure experimental validity and reproducibility when studying the recombinant protein's properties and functions .

How can site-directed mutagenesis be used to study functional domains of ATP synthase subunit b?

Site-directed mutagenesis offers a powerful approach to understand structure-function relationships in ATP synthase subunit b. Based on current methodologies:

  • Dimerization interface mutations: Introducing mutations at the dimerization interface can help understand how subunit b dimerization affects complex stability and activity. This approach is similar to studies on the F₁F₀ ATP synthase β subunit, where phosphomimetic mutations at T262 abolished activity while nonphosphorylatable mutations maintained normal function .

  • F₁ interaction domain mutations: Strategic mutations in the C-terminal region that interacts with F₁ can reveal how this interaction affects coupling efficiency.

  • Membrane anchor modifications: Alterations in the N-terminal membrane anchor can provide insights into proper membrane integration and stability.

  • Conserved residue analysis: Mutation of evolutionarily conserved residues across bacterial species can identify critical functional amino acids.

When designing mutagenesis experiments, researchers should use the T7 expression system with BL21(DE3) cells for optimal expression of mutant proteins . For functional assays, ATP synthesis/hydrolysis activity should be measured in reconstituted systems containing the mutant subunit b.

What approaches can be used to study the interaction between ATP synthase subunit b and other components of the F₁F₀ complex?

Multiple experimental approaches can be employed to study interactions between ATP synthase subunit b and other complex components:

  • Co-immunoprecipitation studies: Using tagged versions of subunit b to pull down interacting partners

  • Cross-linking experiments: Chemical cross-linking followed by mass spectrometry to identify points of contact within the complex

  • Fluorescence resonance energy transfer (FRET): By tagging subunit b and potential interaction partners with fluorescent proteins to monitor real-time interactions in living cells

  • Bacterial two-hybrid assays: To screen for protein-protein interactions in vivo

  • Surface plasmon resonance: For quantitative binding analysis between purified components

  • Cryo-electron microscopy: To visualize the intact complex architecture and subunit positioning

An experimental design comparing wild-type interactions with those of mutated versions can reveal critical interaction domains. Additionally, the construction of chimeric proteins between different bacterial species can identify species-specific interaction characteristics .

How does phosphorylation affect ATP synthase function and how can this be studied in E. coli O6:K15:H31?

Phosphorylation represents an important regulatory mechanism for ATP synthase activity. In eukaryotic systems, phosphorylation of the β subunit affects both structure and function of the complex. To study potential phosphorylation in E. coli ATP synthase:

  • Phosphoproteomics approach: Use mass spectrometry-based phosphoproteomics to identify potential phosphorylation sites on subunit b under different growth conditions.

  • Phosphomimetic mutations: Generate phosphomimetic (e.g., S→D or S→E) and non-phosphorylatable (S→A) mutations at potential phosphorylation sites to study their impact on ATP synthase assembly and function.

  • In vitro phosphorylation: Perform in vitro phosphorylation assays using purified kinases to identify enzymes capable of modifying subunit b.

  • Functional implications: Measure ATP synthesis/hydrolysis rates in reconstituted systems containing wild-type versus phosphomimetic subunit b variants.

Studies of the F₁F₀ ATP synthase β subunit have demonstrated that phosphomimetic mutations at specific sites (e.g., T262E) can abolish activity, while other sites (T58) alter complex dimerization . Similar regulatory mechanisms might exist for subunit b, particularly in pathogenic strains where metabolic adaptation is crucial for survival.

How can ATP synthase regeneration systems be optimized for in vitro studies with recombinant components?

Optimizing ATP regeneration systems for in vitro studies with recombinant ATP synthase components requires careful consideration of several factors:

  • Polyphosphate-based systems: Utilizing thermostable polyphosphate kinase (PPK) from Thermus thermophilus can create a cost-effective ATP regeneration system. This approach has been shown to provide ATP equivalents at a fraction of the cost of direct ATP addition .

  • Coupled enzyme systems: Implementing coupled enzyme systems involving pyruvate kinase and phosphoenolpyruvate can maintain steady-state ATP levels during extended reactions.

  • Heat-treated recombinant system: For thermostable components, heat-treated E. coli producing PPK T can serve as an ATP regenerator platform that remains stable for at least one week at 70°C .

  • Optimization parameters:

    • Temperature: Adjust based on the thermostability of recombinant components

    • pH: Optimize between 5-7 for maximal activity

    • Magnesium concentration: Critical for ATP synthase function (4-10 mM optimal)

    • Ammonium and potassium salt concentrations: May inhibit activity at high levels

The advantage of using polyphosphate as a phosphagen is its cost-effectiveness—a commercial form costing $9/lb can provide ATP equivalents that would cost over $2,000/lb if purchased directly .

What are the advantages of using uropathogenic E. coli O6:K15:H31 as a model system for ATP synthase studies?

Uropathogenic E. coli O6:K15:H31 (strain 536) offers several advantages as a model system for ATP synthase studies:

  • Well-characterized pathogenicity: The strain contains five pathogenicity islands (PAIs) that have been fully sequenced, providing context for metabolic adaptations relevant to pathogenesis .

  • Metabolic adaptation: As a uropathogen, this strain has evolved metabolic strategies for survival in the urinary tract, potentially involving unique adaptations in energy production systems.

  • Genomic resources: The complete genome sequence and genetic tools are available for this strain, facilitating genetic manipulation.

  • Clinical relevance: Findings may have translational implications for understanding bacterial pathogenesis and antibiotic resistance mechanisms.

  • Comparative studies: The strain allows for comparative studies between pathogenic and non-pathogenic E. coli to identify strain-specific ATP synthase characteristics.

Researchers can leverage these advantages when designing experiments to understand the relationship between pathogenicity and energy metabolism in this clinically relevant strain .

What expression systems are most effective for producing recombinant ATP synthase subunit b?

Based on current research protocols, the following expression systems are most effective for producing recombinant ATP synthase subunit b:

Bacterial Expression Systems:

  • E. coli BL21(DE3) with pET vectors: The most widely used system, offering high yields and ease of use. The pET21-b vector has been successfully used for expressing thermostable ATP regeneration components .

  • E. coli Rosetta(DE3)pLysS: Particularly useful when the target protein contains rare codons, enhancing expression levels of proteins with codon bias .

Expression Optimization Parameters:

ParameterRecommended ConditionNotes
Induction0.5-1.0 mM IPTGLower concentrations (0.1-0.3 mM) may improve solubility
Temperature18-25°C post-inductionLower temperatures reduce inclusion body formation
MediaTB or auto-inductionSuperior to LB for membrane protein expression
Induction timingOD₆₀₀ of 0.6-0.8Critical for optimal expression
Co-expressionGroEL/ES chaperonesMay improve folding of complex proteins

Purification Strategy:
His-tagged recombinant proteins can be efficiently purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA columns. For optimal results with membrane proteins like subunit b, adding 0.05-0.1% mild detergent (DDM or LDAO) during lysis and purification helps maintain protein solubility .

What strategies can be employed to improve the solubility and stability of recombinant ATP synthase subunit b?

Improving solubility and stability of recombinant ATP synthase subunit b requires addressing its hydrophobic nature as a membrane protein component:

  • Fusion tags:

    • N-terminal MBP (maltose-binding protein) tag significantly enhances solubility

    • SUMO tag improves folding and solubility while being removable with specific proteases

    • GST (glutathione S-transferase) provides solubility but may interfere with membrane protein folding

  • Expression conditions:

    • Lower temperature induction (16-20°C) substantially improves proper folding

    • Co-expression with molecular chaperones (GroEL/ES, DnaK/J)

    • Addition of 5-10% glycerol to growth media

  • Detergent screening:

    • A systematic detergent screen is crucial for membrane protein solubilization

    • Consider a panel including DDM, LDAO, CHAPS, and Fos-choline detergents

  • Buffer optimization:

    ComponentRecommended RangePurpose
    Salt (NaCl)150-300 mMReduces electrostatic aggregation
    Glycerol5-10%Stabilizes protein structure
    pH7.2-8.0Optimal for stability
    Reducing agent1-5 mM DTT or 0.5-2 mM TCEPPrevents oxidation
  • Cell-free expression systems: Consider E. coli-based cell-free systems with added detergents or lipids for direct incorporation into micelles or liposomes during synthesis .

What experimental designs are appropriate for studying ATP synthase assembly in E. coli O6:K15:H31?

Several experimental designs are suitable for investigating ATP synthase assembly in E. coli O6:K15:H31:

  • Time-course assembly analysis:

    • Pulse-chase experiments with radiolabeled amino acids

    • Sequential sampling during expression followed by BN-PAGE (Blue Native PAGE) analysis

    • Correlating the appearance of assembly intermediates with functional activity

  • Genetic knockout and complementation:

    • Use the equivalent time-samples design to test assembly after controlled expression of individual subunits

    • Complementation studies with mutated versions of atpF to identify critical assembly regions

  • Co-expression studies:

    • Co-express atpF with other ATP synthase components to identify assembly dependencies

    • Compare assembly efficiency between wild-type and mutant components using the nonequivalent control group design

  • Fusion reporter system:

    • Fusion of fluorescent proteins to atpF and other components

    • Live-cell monitoring of assembly process using FRET or split-fluorescent protein approaches

  • Cross-linking time course:

    • Sequential cross-linking during assembly followed by mass spectrometry

    • Identification of transient and stable interactions during the assembly process

How can I design experiments to compare ATP synthase function between pathogenic and non-pathogenic E. coli strains?

When comparing ATP synthase function between pathogenic (O6:K15:H31) and non-pathogenic E. coli strains, consider the following experimental design approaches:

  • Multiple time-series design :

    • Measure ATP synthesis/hydrolysis rates in both strain types under identical conditions over time

    • Analyze adaptation to changing environmental conditions (pH, nutrient availability, antimicrobial agents)

  • Equivalent materials design :

    • Use isogenic strains differing only in pathogenicity determinants

    • Analyze ATP synthase activity using standardized preparations and conditions

  • Comparative functional assays:

    • Membrane vesicle preparations for direct measurement of ATP synthesis activity

    • Luciferase-based ATP quantification in whole cells under various conditions

    • Proton pumping assays using pH-sensitive fluorescent dyes

  • Structural comparison:

    • BN-PAGE analysis of complex assembly and stability

    • Cross-linking mass spectrometry to identify structural differences

    • Cryo-EM structural analysis of purified complexes

  • Transcriptional and translational regulation:

    • qRT-PCR analysis of ATP synthase gene expression under various conditions

    • Ribosome profiling to assess translational efficiency

    • Proteomics to quantify absolute amounts of ATP synthase components

Statistical considerations: Implement factorial designs with strain type, growth conditions, and environmental stressors as factors. This allows for detection of interaction effects between pathogenicity and environmental responses .

What controls should be included when analyzing phosphorylation patterns of ATP synthase components?

When analyzing phosphorylation patterns of ATP synthase components, particularly subunit b, include these essential controls:

  • Sample preparation controls:

    • Phosphatase-treated samples to establish baseline non-phosphorylated state

    • In vitro phosphorylated samples (using purified kinases) as positive controls

    • Identical preparation of samples to minimize artifacts

  • Technical controls for phosphoproteomic analysis:

    • Internal standard phosphopeptides for quantification

    • Fractionation controls to ensure comparable coverage

    • Multiple enrichment techniques (TiO₂, IMAC) to maximize phosphopeptide detection

  • Biological condition controls:

    • Multiple biological replicates (minimum n=3)

    • Time course analysis to capture dynamic phosphorylation changes

    • Comparison between different growth conditions

  • Validation controls:

    • Phospho-specific antibodies (if available)

    • Parallel analysis using different analytical techniques

    • Functional validation with phosphomimetic and non-phosphorylatable mutants

Based on phosphorylation studies of the F₁F₀ ATP synthase β subunit, site-specific phosphorylation can significantly impact both structure and function. For example, phosphomimetic mutations at T262 abolished ATPase activity while the non-phosphorylatable version maintained wild-type activity levels. Similar regulatory mechanisms may exist for subunit b .

What purification strategies are most effective for recombinant ATP synthase subunit b?

Effective purification of recombinant ATP synthase subunit b requires a specialized approach due to its membrane protein characteristics:

  • Solubilization strategy:

    • Optimal detergent selection is critical; DDM (n-dodecyl β-D-maltoside) at 1% is often effective

    • Solubilization should be performed at 4°C for 1-2 hours with gentle agitation

    • Addition of 10% glycerol improves stability during solubilization

  • IMAC purification protocol:

    • For His-tagged atpF, use HisTrap chromatography with these optimized conditions :

      • Binding buffer: 50 mM HEPES-KOH (pH 7.2), 300 mM NaCl, 10% glycerol, 0.05% DDM, 20 mM imidazole

      • Wash buffer: Same as binding buffer with 50 mM imidazole

      • Elution buffer: Same as binding buffer with 250-300 mM imidazole

      • Flow rate: 0.5-1 ml/min for optimal binding

  • Secondary purification:

    • Size exclusion chromatography (Superdex 200) to separate monomeric and dimeric forms

    • Ion exchange chromatography as a polishing step

  • Quality assessment:

    Analysis MethodPurposeAcceptance Criteria
    SDS-PAGEPurity assessment>90% purity
    Western blotIdentity confirmationSingle band at expected MW
    Mass spectrometrySequence verification>80% sequence coverage
    Circular dichroismSecondary structureα-helical content >60%
  • Storage conditions:

    • Store at -80°C in small aliquots containing 10% glycerol

    • Avoid repeated freeze-thaw cycles

    • For functional studies, reconstitution into liposomes may provide better stability

How can I optimize the reconstitution of recombinant ATP synthase subunit b into functional complexes?

Optimizing reconstitution of recombinant ATP synthase subunit b into functional complexes requires careful attention to several critical parameters:

  • Reconstitution protocols:

    • Co-expression strategy: Express multiple ATP synthase components simultaneously in E. coli to facilitate natural assembly

    • Step-wise addition: Add purified components in the order they naturally assemble (c-ring → F₁ → stator components → a/A6L)

    • Liposome reconstitution: For functional studies, incorporate into liposomes using a detergent removal approach

  • Optimized lipid composition:

    • E. coli polar lipid extract provides a native-like environment

    • A mixture of POPC:POPE:POPG (7:2:1) serves as a synthetic alternative

    • Cholesterol addition (10%) may enhance stability for certain applications

  • Critical parameters for functional reconstitution:

    ParameterRecommended RangeImpact on Reconstitution
    Protein:lipid ratio1:50 to 1:200 (w/w)Affects density of complexes
    pH7.0-7.5Influences complex stability
    Ionic strength100-150 mM NaClAffects membrane integrity
    Temperature4°C for assembly, 25°C for functionBalance between stability and activity
    Detergent removal rateSlow (>4 hours)Critical for proper orientation
  • Functional validation methods:

    • ATP synthesis assays using artificially generated proton gradient

    • ATP hydrolysis assays with colorimetric phosphate detection

    • Proton pumping assays using pH-sensitive fluorescent dyes

Studies have shown that the assembly of ATP synthase follows a modular pathway, with the peripheral stalk (including subunit b) playing a critical role in stabilizing the c-ring/F₁ complex . Optimizing this reconstitution process is essential for functional studies of the complex.

What are common challenges in expressing recombinant ATP synthase components and how can they be addressed?

Researchers face several challenges when expressing recombinant ATP synthase components, particularly membrane proteins like subunit b:

  • Toxicity to host cells:

    • Challenge: Overexpression can disrupt host cell membrane integrity

    • Solution: Use tightly controlled expression systems (pLysS strains), lower IPTG concentrations (0.1-0.3 mM), and lower growth temperatures (16-20°C)

  • Inclusion body formation:

    • Challenge: Improper folding leads to insoluble aggregates

    • Solution: Co-express with chaperones (GroEL/ES), use solubility tags (MBP, SUMO), and optimize induction conditions

  • Low yield:

    • Challenge: Membrane proteins often express at lower levels

    • Solution: Use strong promoters (T7), optimize codon usage, and use specialized media (TB or auto-induction)

  • Proteolytic degradation:

    • Challenge: Partial folding can expose protease-sensitive sites

    • Solution: Include protease inhibitors, use protease-deficient strains, and optimize buffer conditions

  • Proper assembly:

    • Challenge: Multi-subunit complexes require coordinated assembly

    • Solution: Co-expression strategies or step-wise reconstitution following the natural assembly pathway

Case study approach to common issues:

ProblemPossible CausesDiagnostic TestSolution
No expressionToxicity, plasmid lossColony PCR, growth curveUse C41/C43 strains designed for membrane proteins
Expression but insolubleInclusion bodiesSolubility test with different detergentsLower temperature, co-express chaperones
Degraded productProteolysisWestern blot time courseAdd protease inhibitors, reduce expression time
Inactive proteinImproper foldingCircular dichroism, limited proteolysisOptimize refolding conditions, use fusion partners

These approaches have been demonstrated effective for various ATP synthase components in published protocols .

How can I verify the proper folding and assembly of recombinant ATP synthase subunit b?

Verifying proper folding and assembly of recombinant ATP synthase subunit b requires multiple complementary techniques:

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy: Confirms expected secondary structure content (predominantly α-helical)

    • Thermal denaturation: Properly folded protein shows cooperative unfolding with defined Tm

    • Limited proteolysis: Correctly folded proteins show resistance to proteolysis at specific sites

  • Oligomeric state analysis:

    • Size exclusion chromatography: Determines if proper dimerization occurs

    • Analytical ultracentrifugation: Provides precise molecular weight and shape information

    • Native PAGE: Demonstrates formation of native-like complexes

  • Functional verification:

    • Binding assays: Interaction with other ATP synthase components (F₁ domain, a-subunit)

    • Assembly complementation: Ability to restore function in depleted systems

    • ATP synthesis/hydrolysis: Activity measurements in reconstituted systems

  • Structural integrity analysis:

    TechniqueInformation ProvidedAcceptance Criteria
    Tryptophan fluorescenceTertiary structureEmission maximum at expected wavelength
    FTIRSecondary structureCharacteristic amide I/II bands
    DSCThermal stabilitySingle cooperative transition
    Cross-linkingOligomeric contactsSpecific cross-linked products

The peripheral stalk, which includes subunit b, plays a crucial role in stabilizing the c-ring/F₁ complex during assembly . Therefore, verification of its proper folding and assembly is essential for functional studies of the ATP synthase complex.

What are the best approaches for studying the role of ATP synthase in pathogenicity of E. coli O6:K15:H31?

Investigating the role of ATP synthase in E. coli O6:K15:H31 pathogenicity requires integrated approaches:

  • Genetic manipulation strategies:

    • Conditional knockdowns: Use inducible antisense RNA to deplete atpF under specific conditions

    • Point mutations: Create site-directed mutations in atpF to affect function without eliminating expression

    • Domain swapping: Exchange atpF regions between pathogenic and non-pathogenic strains

  • Infection model experiments:

    • Cell culture infection assays: Compare wild-type and ATP synthase-modified strains for adherence, invasion, and intracellular survival

    • Animal models: Assess colonization and virulence in urinary tract infection models

    • Competition assays: Co-infection with wild-type and mutant strains to determine fitness costs

  • Environmental stress responses:

    • pH adaptation: Compare ATP synthase function between strains under urinary tract-relevant pH conditions

    • Antimicrobial peptide resistance: Assess membrane potential maintenance under peptide challenge

    • Nutrient limitation: Compare energy production efficiency under host-relevant nutrient conditions

  • Experimental design considerations:

    • Implement quasi-experimental designs like multiple time-series design or equivalent materials design

    • Include appropriate controls addressing the common threats to valid inference

    • Use factorial designs to detect interaction effects between ATP synthase function and environmental factors

How should I analyze data from ATP synthase activity assays to identify subtle functional differences?

Analyzing ATP synthase activity data requires careful statistical consideration to identify meaningful functional differences:

  • Data preprocessing procedures:

    • Normalize to protein concentration using Bradford or BCA assays

    • Apply appropriate blank corrections for each experimental condition

    • Transform data if necessary to meet statistical assumptions (log transformation often appropriate)

  • Statistical analysis approach:

    • Use factorial ANOVA for multiple condition comparisons

    • Apply repeated measures designs for time-course experiments

    • Consider non-parametric alternatives (Kruskal-Wallis) if normality assumptions are violated

  • Enhanced sensitivity methods:

    • Calculate initial velocities using early time points to maximize sensitivity

    • Employ enzyme kinetic modeling (Michaelis-Menten) to extract Vmax and Km parameters

    • Use relative activity ratios (ATP synthesis/hydrolysis) as sensitive indicators of coupling efficiency

  • Data visualization strategies:

    Plot TypeBest Used ForAdvantage
    Box plots with individual data pointsDistribution comparisonShows spread and outliers
    Kinetic parameter bar charts with error barsComparing derived parametersSimplified comparison
    Heat mapsMultiple condition screeningIdentifies patterns across conditions
    Volcano plotsComparing multiple mutantsHighlights statistically significant differences
  • Interpretation framework:

    • Compare to both positive (wild-type) and negative (known inactive) controls

    • Consider biological significance beyond statistical significance

    • Correlate activity differences with structural data when available

Studies on ATP synthase β subunit have shown that phosphomimetic mutations at specific sites can completely abolish activity (T262E) or alter complex formation (T58E) . Similar subtle but functionally important differences may exist for subunit b mutations and should be carefully analyzed.

What statistical approaches are appropriate for analyzing the impact of mutations in ATP synthase subunit b?

When analyzing the impact of mutations in ATP synthase subunit b, appropriate statistical approaches include:

  • For functional data:

    • One-way ANOVA with post-hoc tests: When comparing multiple mutants to wild-type

    • Dunnett's test: Specifically designed for comparing multiple experimental groups to a single control

    • Regression discontinuity analysis: For analyzing the relationship between structural changes and functional outcomes

  • For structural stability data:

    • Survival analysis techniques: For thermal stability data with time-to-unfold measurements

    • Paired t-tests: For direct comparisons between wild-type and single mutants

    • Hierarchical clustering: To identify mutations with similar effects

  • For complex multi-parameter data:

    • Principal Component Analysis (PCA): To identify patterns across multiple measured parameters

    • Multiple regression models: To determine which structural changes best predict functional outcomes

    • Random Forest analysis: For identifying complex interaction patterns between mutations

  • Experimental design considerations:

    • Use factorial designs when testing combinations of mutations to detect interaction effects

    • Apply the equivalent materials design when comparing homologous mutations across species

    • Implement counterbalanced designs when testing under multiple conditions

  • Statistical power considerations:

    • Power calculations based on preliminary data suggest n≥3 biological replicates for detecting 25% activity differences

    • For subtle effects (<15% difference), n≥5 is recommended

    • Technical replicates (≥3) should be used to minimize measurement error

When analyzing mutation effects, researchers should follow experimental design principles as outlined in Campbell & Stanley's framework , particularly addressing threats to internal validity when comparing mutant constructs.

How do I interpret contradictory results between different experimental approaches when studying ATP synthase?

Contradictory results between experimental approaches studying ATP synthase are common and require systematic interpretation:

  • Systematic reconciliation framework:

    • Create a comprehensive comparison table listing all contradictions

    • Evaluate methodological differences that might explain discrepancies

    • Identify variables not controlled across methods

    • Consider whether discrepancies reflect different aspects of the same phenomenon

  • Common sources of contradictions and solutions:

    Type of ContradictionPossible CausesResolution Strategy
    In vitro vs. in vivo resultsMissing cellular factors, non-physiological conditionsStepwise complexity approach, identify missing factors
    Structural vs. functional dataDynamic states captured differentlyConduct structure-function correlation with varied conditions
    Genetic vs. biochemical approachesCompensatory mechanisms, indirect effectsCombined approaches, conditional systems
    Different expression systemsPost-translational modifications, folding environmentComparative analysis across systems, standardize conditions
  • Specialized resolution approaches:

    • Controlled variable testing: Systematically vary conditions to identify critical parameters

    • Orthogonal method validation: Confirm key findings using conceptually different approaches

    • Time-resolved analysis: Discrepancies may reflect different temporal stages of the same process

  • Integration strategies:

    • Develop models that incorporate data from multiple experimental approaches

    • Weight evidence based on methodological strengths and limitations

    • Consider evolutionary conservation as a factor in evaluating contradictory results

Phosphorylation studies of ATP synthase β subunit demonstrated that specific mutations (T262E) completely abolished activity while others (T58E) altered complex formation . These seemingly contradictory outcomes actually revealed different functional roles of phosphorylation sites. Similar nuanced interpretation may be necessary for subunit b experimental results.

What bioinformatic approaches can help identify functional domains in ATP synthase subunit b?

Multiple bioinformatic approaches can help identify functional domains in ATP synthase subunit b:

  • Sequence analysis methods:

    • Multiple sequence alignment (MSA): Identifies conserved residues across species

    • Hydropathy analysis: Predicts membrane-spanning regions

    • Coevolution analysis: Identifies residues that evolve together, suggesting functional coupling

    • Motif identification: Locates known functional motifs in the sequence

  • Structure prediction approaches:

    • Secondary structure prediction: Tools like PSIPRED to predict α-helices and β-sheets

    • Disorder prediction: Identifies flexible regions that may be involved in protein-protein interactions

    • Homology modeling: Based on known structures of homologous proteins

    • Recent AI-based structure prediction: AlphaFold2 and RoseTTAFold provide high-accuracy predictions

  • Functional prediction methods:

    • Phosphorylation site prediction: Tools like NetPhos to identify potential regulatory sites

    • Protein-protein interaction sites: Prediction of interfaces based on surface properties

    • Post-translational modification sites: Prediction of glycosylation, acetylation, etc.

  • Integrated analysis workflow:

    Analysis StepToolsOutcome
    Initial sequence analysisClustal Omega, MUSCLEMultiple sequence alignment
    Conservation mappingConSurf, Rate4SiteIdentification of conserved residues
    Structural predictionAlphaFold2, I-TASSER3D structural model
    Functional domain mappingInterProScan, PfamAnnotation of known domains
    Molecular dynamics simulationGROMACS, NAMDDynamic behavior of the protein
  • Validation approaches:

    • Experimental testing of predicted functional sites through mutagenesis

    • Correlation of predictions with existing biochemical data

    • Cross-validation using different prediction algorithms

The integration of these bioinformatic approaches can reveal structural and functional characteristics of ATP synthase subunit b, providing insights into its role in complex assembly and function .

How can I correlate structural data with functional assays when studying ATP synthase components?

Correlating structural data with functional assays for ATP synthase components requires an integrated analysis approach:

  • Structure-function mapping strategies:

    • Systematic mutagenesis: Create a library of mutations spanning the protein and assess functional impact

    • Domain swapping: Exchange domains between functional and non-functional homologs

    • Residue-specific modification: Chemical modification or unnatural amino acid incorporation at specific sites

  • Integrated data analysis framework:

    • Create a unified database linking structural parameters to functional outcomes

    • Apply machine learning approaches to identify structural predictors of function

    • Develop mathematical models relating structural features to functional parameters

  • Visualization approaches:

    MethodApplicationValue
    Heat map projection onto structuresMap functional data onto 3D modelsVisual correlation of structure and function
    Distance-activity plotsCorrelate distances between residues with activity changesIdentify critical interactions
    Conformational energy landscapesMap functional states to energy statesUnderstand energetic drivers
    Network analysis graphsVisualize residue interaction networksIdentify allosteric pathways
  • Case study approach:

    • Use well-characterized mutations as benchmarks

    • Develop structure-based hypotheses and test with targeted mutations

    • Apply molecular dynamics simulations to predict functional impacts of structural changes

  • Statistical methods for correlation:

    • Pearson or Spearman correlation between structural parameters and function

    • Multiple regression models incorporating multiple structural features

    • Principal component analysis to identify patterns across structural variables

Studies of ATP synthase β subunit demonstrated that phosphomimetic mutations at T262 abolished activity, while similar mutations at T58 altered complex formation . By correlating these functional changes with structural data, researchers gained insights into how phosphorylation regulates ATP synthase at a molecular level. Similar approaches can be applied to subunit b studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.