Recombinant Escherichia coli O6:K15:H31 Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aas; ECP_2849; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
aas
Target Protein Sequence
MLFSFFRNLCRVLYRVRVTGDTKALKGERVLITPNHVSFIDGILLALFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERDWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELMRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE
Uniprot No.

Target Background

Function

This bifunctional protein plays a critical role in lysophospholipid acylation. It facilitates the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its physiological function is to regenerate phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), which is produced through transacylation reactions or phospholipase A1 degradation.

Database Links

KEGG: ecp:ECP_2849

Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Bifunctional protein aas from E. coli O6:K15:H31, and what makes it significant for research?

The Bifunctional protein aas (aas) from Escherichia coli O6:K15:H31 is a 719-amino acid protein that performs two distinct enzymatic functions: 2-acylglycerophosphoethanolamine (2-acyl-GPE) acyltransferase and acyl-acyl carrier protein (acyl-ACP) synthetase activity. This dual functionality makes it significant for understanding bacterial membrane lipid metabolism and repair mechanisms. The protein is encoded by the aas gene, which consists of a single open reading frame of 2,157 base pairs, predicting a protein of approximately 80.6 kDa . The recombinant version is typically produced with a His-tag to facilitate purification and comes in a lyophilized powder form . The bifunctional nature of this protein represents an interesting case of evolutionary optimization, where two enzymatic activities related to fatty acid and phospholipid metabolism are combined into a single polypeptide.

What are the specific enzymatic activities of the aas protein and how do they function biochemically?

The aas protein performs two distinct but related enzymatic activities:

  • 2-Acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40): This activity is responsible for transferring an acyl group to 2-acyl-GPE (lysophospholipid), converting it to phosphatidylethanolamine, a major component of bacterial cell membranes. This activity facilitates membrane lipid recycling and repair .

  • Acyl-ACP synthetase: This activity catalyzes the activation of free fatty acids by attaching them to acyl carrier protein (ACP), making them available for incorporation into phospholipids. This represents a key step in lipid biosynthesis and recycling pathways .

These two complementary activities allow the protein to both salvage fatty acids and reincorporate them into membrane phospholipids, providing E. coli with efficient mechanisms for membrane homeostasis and adaptation to environmental changes.

How is the recombinant aas protein typically produced, and what expression systems yield optimal results?

Recombinant aas protein is typically produced in E. coli expression systems using standard recombinant protein techniques. The production process includes:

  • Vector Construction: The aas gene (1-719 aa) is cloned into an expression vector with an N-terminal His-tag for purification purposes .

  • Host Selection: E. coli is the preferred expression host for this bacterial protein, providing the necessary cellular machinery for proper folding and post-translational modifications .

  • Expression Optimization: Parameters such as temperature, induction conditions, and growth media composition need to be optimized for highest soluble protein yield. According to studies on recombinant protein expression, factors like induction time (optimally 4-6 hours), media composition, and inducer concentration play critical roles in maximizing yield .

  • Purification Strategy: Ni-NTA affinity chromatography leveraging the His-tag is commonly used for initial purification, potentially followed by additional chromatography steps to achieve higher purity .

A systematic experimental design approach, testing multiple variables simultaneously rather than a traditional one-variable-at-a-time approach, has been shown to significantly improve recombinant protein yields, especially for proteins with complex functions like aas .

How can researchers optimize experimental conditions to maximize both enzymatic activities of the bifunctional aas protein?

Optimizing experimental conditions to maximize both enzymatic activities requires a multivariate approach due to the bifunctional nature of the protein. Based on research with other bifunctional proteins and recombinant protein optimization studies, the following methodology is recommended:

Experimental Design Approach:

  • Employ Design of Experiments (DoE): Use factorial design to simultaneously evaluate multiple parameters including pH, temperature, cofactor concentrations, and substrate ratios .

  • Activity-Based Optimization Matrix: Consider creating a matrix with conditions tested against both enzymatic activities:

ParameterRange to Test2-acyl-GPE acyltransferaseAcyl-ACP synthetase
pH6.0-9.0Measured activityMeasured activity
Temperature25-45°CMeasured activityMeasured activity
Metal ionsMg²⁺, Mn²⁺, Ca²⁺Measured activityMeasured activity
Reducing agentsDTT, β-MEMeasured activityMeasured activity
  • Response Surface Methodology: After initial screening, employ response surface methodology to identify optimal conditions that balance both activities .

  • Domain-Specific Studies: Consider separate optimization studies for each domain if the optimal conditions for each activity differ significantly. This approach can help identify conditions where both activities reach acceptable levels, even if neither is at its maximum .

This systematic approach allows researchers to balance conditions that favor both enzymatic activities, which is particularly important when studying bifunctional proteins like aas.

What techniques can be used to investigate the structural relationship between the two functional domains of the aas protein?

Several advanced techniques can be employed to investigate the structural relationship between the two functional domains of aas protein:

Based on research with other bifunctional proteins, it's valuable to investigate whether the two activities of aas influence each other through allosteric mechanisms, or if they function independently despite being on the same polypeptide chain.

How does the recombinant aas protein compare to the native protein in terms of activity and stability?

When comparing recombinant aas protein to its native counterpart, several key factors should be systematically evaluated:

  • Enzymatic Activity Comparison:

    • Specific Activity: The recombinant protein may show different specific activities for both functions compared to the native protein extracted from E. coli O6:K15:H31.

    • Kinetic Parameters: Determine Km and Vmax values for both activities in native and recombinant proteins.

    • Substrate Specificity Profiles: Test whether the recombinant protein maintains the same preference for fatty acid chain lengths and lysophospholipid species.

  • Stability Assessment:

    • Thermal Stability: Compare thermal denaturation profiles using differential scanning calorimetry or thermal shift assays.

    • Storage Stability: Evaluate activity retention over time at different storage conditions (-80°C, -20°C, 4°C).

    • pH Stability Range: Determine the pH range where both forms maintain activity.

  • Structural Integrity:

    • Circular Dichroism: Compare secondary structure content.

    • Limited Proteolysis Patterns: Assess domain organization and accessibility.

    • Size Exclusion Chromatography: Evaluate oligomerization state.

Research with other bifunctional proteins has shown that recombinant versions sometimes exhibit altered properties due to:

  • The presence of affinity tags (His-tag in this case)

  • Different post-translational modifications

  • Altered folding kinetics in heterologous expression systems

  • Different buffer compositions during purification and storage

For example, the recombinant His-tagged aas is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 , which may affect its properties compared to the native cytoplasmic environment in E. coli.

What analytical methods can be used to measure the dual enzymatic activities of the bifunctional aas protein?

Accurate measurement of both enzymatic activities requires specific and sensitive assays. Based on the biochemical nature of these activities, the following methods are recommended:

For 2-acyl-GPE acyltransferase activity:

  • Radiometric Assay: Using [14C]-labeled acyl donors and thin-layer chromatography (TLC) separation of products.

    • Advantages: High sensitivity, direct quantification

    • Methodology: Incubate recombinant aas with [14C]-acyl-CoA (or acyl-ACP) and 2-acyl-GPE, extract lipids, separate by TLC, and quantify radioactivity

  • HPLC-Based Assay: Monitoring the formation of phosphatidylethanolamine.

    • Advantages: No radioactivity, allows for kinetic measurements

    • Methodology: Separate reaction products on reverse-phase HPLC with UV or evaporative light-scattering detection

  • Coupled Enzyme Assay: Measuring CoA release during the reaction.

    • Advantages: Continuous monitoring, adaptable to plate format

    • Methodology: Couple CoA release to NADH oxidation through pyruvate kinase and lactate dehydrogenase

For acyl-ACP synthetase activity:

  • ATP Consumption Assay: Monitoring ATP hydrolysis during acyl-ACP formation.

    • Advantages: High-throughput capability

    • Methodology: Couple ADP formation to NADH oxidation through pyruvate kinase and lactate dehydrogenase

  • Gel-Shift Assay: Analyzing ACP mobility change upon acylation.

    • Advantages: Directly visualizes product formation

    • Methodology: Native PAGE analysis of reaction products, with unacylated and acylated ACP showing different migration patterns

  • Mass Spectrometry: Detecting acylated ACP formation.

    • Advantages: High specificity, can identify acyl chain specificity

    • Methodology: MALDI-TOF or ESI-MS analysis of reaction products

Each method has its strengths and limitations. It's often valuable to confirm activity results using complementary approaches, particularly when studying a bifunctional enzyme like aas where one activity might influence the other.

How can researchers optimize the solubility and yield of recombinant aas protein during expression?

Optimizing solubility and yield of recombinant aas protein requires systematic approach to multiple parameters. Based on established practices in recombinant protein production , the following strategies are recommended:

Expression Optimization Matrix:

ParameterStrategyImplementation
TemperatureReduce to 16-25°C during inductionSlows protein production rate, allowing proper folding
Induction conditionsTest IPTG concentrations (0.1-1.0 mM)Lower concentrations often improve solubility
Expression timeLimit to 4-6 hoursExtended expression can lead to inclusion body formation
Media compositionTry enriched media (TB, 2YT)Provides metabolic precursors for proper folding
Fusion tagsConsider solubility-enhancing tagsMBP, SUMO, or TrxA can improve solubility
Co-expressionChaperones (GroEL/ES, DnaK)Assists protein folding

Experimental Design Approach:

  • Use fractional factorial design to simultaneously test multiple parameters (temperature, inducer concentration, media, time)

  • Measure both protein yield and solubility fraction for each condition

  • Apply response surface methodology to identify optimal conditions

  • Validate optimized conditions with scaled-up expression

Solubility Enhancement Strategies:

  • Buffer optimization: Test different pH values, salt concentrations, and additives

  • Lysis conditions: Optimize detergent type and concentration for membrane-associated proteins like aas

  • Addition of ligands or substrates: Can stabilize protein during extraction

  • Refolding protocols: If inclusion bodies form, develop efficient refolding methods

This approach has been shown to dramatically improve soluble protein yield for complex bacterial proteins, with studies reporting up to 250 mg/L of soluble recombinant protein through systematic optimization .

What purification strategies are most effective for isolating the recombinant aas protein while preserving both enzymatic activities?

Purifying bifunctional proteins requires careful consideration to maintain both enzymatic activities. Based on the His-tagged nature of recombinant aas protein and general practices for multiple-activity enzymes, the following purification strategy is recommended:

Multi-step Purification Protocol:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC)

    • Buffer conditions: Tris-HCl (20-50 mM, pH 8.0), NaCl (300-500 mM), glycerol (10%)

    • Imidazole: Use low concentration (10-20 mM) in wash buffer to reduce non-specific binding

    • Elution: Gradient elution (20-250 mM imidazole) to monitor activity in different fractions

  • Intermediate Purification: Ion exchange chromatography

    • Based on theoretical pI of aas protein

    • Test both anion exchange (Q-Sepharose) and cation exchange (SP-Sepharose)

    • Monitor both enzymatic activities in eluted fractions

  • Polishing Step: Size exclusion chromatography

    • Separates aggregates and provides buffer exchange

    • Use buffer containing 20 mM Tris-HCl (pH 8.0) with 10% glycerol for stability

Critical Considerations:

  • Activity Preservation: After each purification step:

    • Test samples for both enzymatic activities

    • Calculate specific activity and recovery percentage

    • Identify steps that may selectively affect one activity

  • Stability Enhancers: Consider these additives during purification:

    • Glycerol (10-25%): Prevents aggregation and stabilizes structure

    • Reducing agents (1-5 mM DTT or 2-ME): Maintains cysteine residues

    • Protease inhibitors: Prevents degradation during purification

  • Storage Buffer Optimization:

    • The recombinant aas protein has been successfully stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • For long-term storage, add 50% glycerol and store at -20°C or -80°C

    • Aliquot to avoid freeze-thaw cycles, which can reduce activity

This approach should yield highly pure recombinant aas protein with preserved bifunctional activity.

How can researchers address discrepancies between the two enzymatic activities during experimental analysis?

When working with bifunctional proteins like aas, researchers may encounter situations where the two enzymatic activities show discrepant behavior. Here's a methodological approach to understand and address such discrepancies:

Systematic Investigation Protocol:

  • Verify Independent Activity Measurements:

    • Ensure assay conditions are optimal for each activity

    • Determine if assay components for one activity interfere with the other

    • Use reference substrates with known kinetic parameters for validation

  • Examine Physical Factors:

    • pH dependence: Create activity profiles across pH 5.0-9.5 for both activities

    • Temperature sensitivity: Test activity at 4°C, 25°C, 30°C, 37°C, and 42°C

    • Ionic strength effects: Vary salt concentration and monitor both activities

  • Investigate Structural Considerations:

    • Domain interference: Test whether substrate binding to one domain affects the other

    • Conformational changes: Use circular dichroism or fluorescence to detect structural changes under different conditions

    • Limited proteolysis: Determine if selective degradation of one domain occurs

  • Address Common Discrepancy Scenarios:

Discrepancy TypePossible CausesInvestigation Approach
One activity absentDomain misfoldingTest with denaturants/refolding
Inhibitory buffer componentSystematic buffer screening
Missing cofactorAdd potential cofactors individually
Activities with different stabilityDomain-specific sensitivityThermal inactivation time course
Selective oxidationTest effect of reducing agents
Different substrate preferencesEvolutionary specializationSubstrate screening panel
Steric hindrancesMolecular modeling
  • Resolution Strategies:

    • Create assay conditions that represent a compromise for both activities

    • Develop a correction factor based on systematic characterization

    • Consider generating single-domain constructs for comparative studies

This systematic approach helps ensure accurate characterization of both activities and proper interpretation of experimental results when working with the bifunctional aas protein.

What are the primary research applications for recombinant aas protein in bacterial membrane biology studies?

The bifunctional aas protein serves as a valuable tool for numerous research applications in bacterial membrane biology. Key applications include:

  • Membrane Lipid Homeostasis Studies:

    • Investigation of phospholipid remodeling during environmental stress

    • Analysis of fatty acid recycling pathways in bacteria

    • Examination of membrane adaptation mechanisms during temperature shifts or pH changes

  • Bacterial Fatty Acid Trafficking Research:

    • Tracing the fate of exogenous fatty acids in bacterial cells

    • Understanding the coordination between de novo synthesis and salvage pathways

    • Investigating the role of acyl-ACP in directing fatty acids to different metabolic fates

  • Membrane Repair Mechanisms:

    • Studying 2-acyl-GPE (lysophospholipid) recycling after membrane damage

    • Investigating emergency response to membrane-disrupting agents

    • Analyzing phospholipid turnover rates during normal growth

  • Comparative Biochemistry Applications:

    • Comparing the bifunctional aas with mammalian, yeast, and bacterial long chain acyl-CoA synthetases

    • Investigating domain evolution in lipid metabolism enzymes

    • Studying the adaptive advantages of enzyme fusion versus separate proteins

  • Drug Development Research:

    • As a potential target for antibacterial compounds that disrupt membrane integrity

    • For screening membrane-active compounds that might be countered by aas activity

    • In developing inhibitors specific to bacterial phospholipid remodeling

  • Synthetic Biology Applications:

    • Engineering lipid composition in bacterial production strains

    • Optimizing membrane properties for biofuel tolerance

    • Developing bacterial strains with customized membrane characteristics

The bifunctional nature of aas makes it particularly valuable for studying the intersection of fatty acid activation and phospholipid remodeling pathways, offering insights into the coordinated regulation of these processes in bacterial cells.

What controls and validation experiments should be included when working with recombinant aas protein?

Rigorous controls and validation experiments are essential when working with bifunctional proteins like recombinant aas. The following comprehensive framework ensures reliable results:

Essential Controls for Biochemical Characterization:

  • Protein Quality Controls:

    • Purity assessment: SDS-PAGE with Coomassie staining (>90% purity recommended)

    • Identity confirmation: Western blot using anti-His antibodies and/or mass spectrometry

    • Stability verification: Activity measurements before and after storage periods

  • Activity Assay Controls:

    • Negative controls: Heat-inactivated enzyme, reaction mixtures lacking key substrates

    • Positive controls: Commercial enzyme with similar activity (if available)

    • Buffer controls: Test for interference from buffer components

    • Substrate blanks: Account for non-enzymatic degradation or background signals

  • Specificity Validation:

    • Substrate range testing: Confirm activity with physiologically relevant substrates

    • Inhibition studies: Test known inhibitors of similar enzymes

    • pH and temperature optima: Verify consistent with expected bacterial enzyme properties

Critical Validation Experiments:

  • Structure-Function Validation:

    • Site-directed mutagenesis: Target conserved residues in each domain

    • Domain deletion/truncation: Create single-domain constructs to verify independent activities

    • Fusion protein comparisons: Compare to separately expressed domains (if feasible)

  • Physiological Relevance Testing:

    • Complementation studies: Test if recombinant protein restores function in aas-deficient E. coli

    • In vivo activity correlation: Compare in vitro measurements with cellular effects

    • Substrate competition experiments: Determine preference for physiological substrates

  • Technical Validation:

    • Method comparison: Verify activities using two independent assay methods

    • Linear range determination: Establish enzyme concentration and time ranges for linear activity

    • Reproducibility assessment: Perform inter-day and inter-batch comparisons

How might high-throughput structural biology techniques advance our understanding of the bifunctional aas protein's mechanism?

Advanced structural biology techniques offer promising avenues for elucidating the molecular mechanisms of bifunctional aas protein. Based on current trends in protein science, several approaches could significantly advance our understanding:

  • Cryo-Electron Microscopy (Cryo-EM) Applications:

    • Conformational landscape mapping: Capturing multiple structural states during catalytic cycles

    • Domain interaction visualization: Resolving how the two functional domains communicate

    • Substrate-bound complexes: Determining structures with various substrates and inhibitors

    • Time-resolved studies: Potentially capturing transient intermediates during catalysis

  • Integrative Structural Biology Approaches:

    • Combining X-ray crystallography with SAXS: To understand solution dynamics

    • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): For identifying flexible regions and substrate-binding-induced conformational changes

    • Cross-linking mass spectrometry: To map domain-domain interactions

    • NMR for dynamics: Focusing on smaller domains or fragments if the full protein is too large

  • Computational Methods Integration:

    • Molecular dynamics simulations: Modeling conformational changes during substrate binding

    • Machine learning approaches: Predicting functional motifs and regulatory sites

    • Network analysis: Identifying allosteric pathways between domains

    • Quantum mechanics/molecular mechanics (QM/MM): Modeling the catalytic mechanism in detail

  • Emerging Technologies:

    • Single-molecule FRET: For tracking domain movements during catalysis

    • Microfluidics-coupled structural analysis: For time-resolved studies

    • Serial femtosecond crystallography: To capture short-lived catalytic intermediates

    • AlphaFold2 and other AI-based prediction tools: For modeling structures with various substrates

These approaches can address key questions about the bifunctional aas protein:

  • How do the two active sites coordinate their activities?

  • Does substrate binding to one domain allosterically affect the other domain?

  • What conformational changes occur during the catalytic cycle?

  • Are there shared structural elements that contribute to both activities?

Resolving these questions would significantly advance our understanding of this fascinating bifunctional enzyme and potentially inform the design of inhibitors or engineered variants with enhanced properties.

What experimental approaches can reveal how the bifunctional aas protein is regulated in response to changing cellular conditions?

Understanding the regulation of bifunctional proteins like aas in response to cellular conditions requires integrative experimental approaches spanning from molecular to systems biology. The following research strategies can elucidate regulatory mechanisms:

  • Transcriptional Regulation Studies:

    • RNA-seq analysis: Compare aas expression under various growth conditions

    • Promoter mapping: Characterize the aas promoter region and identify regulatory elements

    • ChIP-seq: Identify transcription factors that bind to the aas promoter

    • Reporter gene assays: Construct promoter-reporter fusions to monitor expression dynamics

  • Post-translational Regulation Investigation:

    • Phosphoproteomics: Identify potential phosphorylation sites

    • Site-directed mutagenesis: Create variants with modified regulatory sites

    • Activity assays under cellular stress: Test enzyme function under oxidative stress, pH shifts, osmotic pressure

    • In vitro modification: Assess the impact of specific modifications (phosphorylation, acetylation) on activity

  • Metabolic Integration Analysis:

    • Metabolomics profiling: Correlate cellular metabolite levels with aas activity

    • Substrate availability studies: Determine how fatty acid and lysophospholipid levels affect activity

    • 13C labeling experiments: Track metabolic flux through pathways involving aas

    • Competitive inhibition studies: Test if cellular metabolites regulate activity allosterically

  • Protein-Protein Interaction Mapping:

    • Co-immunoprecipitation: Identify proteins that interact with aas

    • Proximity labeling (BioID, APEX): Map the protein neighborhood of aas in vivo

    • Two-hybrid screening: Discover potential regulatory partners

    • Split luciferase assays: Monitor dynamic interactions under different conditions

  • Cellular Localization and Dynamics:

    • Fluorescence microscopy: Track aas localization under different conditions

    • FRAP (Fluorescence Recovery After Photobleaching): Measure protein mobility

    • Membrane fractionation: Quantify association with different membrane compartments

    • Super-resolution microscopy: Visualize clustering or complex formation

These approaches would address critical questions about aas regulation:

  • How is expression coordinated with other lipid metabolism enzymes?

  • What cellular signals activate or inhibit each of the two enzymatic activities?

  • How does the protein respond to membrane damage events?

  • What role does aas play in bacterial stress responses?

Understanding these regulatory mechanisms could provide insights into bacterial adaptation strategies and potentially reveal new targets for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.