Recombinant Escherichia coli O6:K15:H31 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; ECP_1296; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function

This recombinant Escherichia coli O6:K15:H31 Cardiolipin synthase (Cls) catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links

KEGG: ecp:ECP_1296

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what role does it play in E. coli?

Cardiolipin synthase (Cls) is an enzyme responsible for the synthesis of cardiolipin (CL), a major anionic phospholipid in bacterial membranes. In Escherichia coli, cardiolipin typically constitutes 5-15% of the total phospholipid content, varying with growth phase and culture conditions. The enzyme catalyzes the condensation reaction of two phosphatidylglycerol (PG) molecules to form cardiolipin and glycerol, although different Cls variants may use different phospholipid donors .

Cardiolipin plays crucial roles in E. coli physiology including:

  • Stabilization of the dimeric state of the Sec-YEG protein channel complex

  • Promotion of polar localization of proteins like ProP

  • Activation of respiratory complexes

  • Formation of anionic lipid domains involved in DNA replication initiation and cell division

  • Providing increased resistance to low osmolarity conditions

  • Supporting long-term viability in stationary phase

How many types of cardiolipin synthases exist in E. coli and how do they differ?

E. coli possesses three distinct cardiolipin synthases, each encoded by different genes:

  • ClsA (encoded by clsA, formerly cls): The primary cardiolipin synthase that catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin and glycerol.

  • ClsB (encoded by clsB, formerly ybhO): Functions similarly to ClsA, using two PG molecules as substrates.

  • ClsC (encoded by clsC, formerly ymdC): Unlike ClsA and ClsB, this enzyme demonstrates a unique reaction mechanism, using phosphatidylethanolamine (PE) as the phosphatidyl donor to PG to form cardiolipin when working together with its neighboring gene product YmdB .

These enzymes show differential activity based on growth conditions:

  • ClsA is the only enzyme contributing detectable levels of CL at low osmolarity during logarithmic growth

  • All three synthases show increased activity with increasing medium osmolarity

  • ClsA activity increases approximately 10-fold when cells enter stationary phase

  • ClsC requires co-expression with YmdB to produce substantial amounts of cardiolipin

What is the basic structure and catalytic mechanism of E. coli cardiolipin synthase?

E. coli cardiolipin synthase A (ClsA) is a 46 kDa protein consisting of 486 amino acids. The enzyme belongs to the phospholipase D superfamily and contains the conserved HKD catalytic motifs characteristic of this family .

The catalytic mechanism involves:

  • Binding of two phosphatidylglycerol substrate molecules

  • Nucleophilic attack by the conserved HKD motif histidine residue on the phosphate group of one PG molecule

  • Transfer of the phosphatidyl group to the second PG molecule

  • Release of glycerol and formation of cardiolipin

The enzyme contains conserved amino acid residues in the core CDP-OH-P motif D(X)2DG(X)2AR(X)8-9G(X)3D(X)3D that are critical for its activity. Mutation of the putative catalytic motif prevents CL formation .

How can recombinant cardiolipin synthase be expressed and purified for research purposes?

Expression Protocol:

  • Clone the cls gene (clsA) with ribosome-binding sites into an expression vector (e.g., pBAD30 with arabinose induction system or a T7 promoter-based system like pET)

  • Transform the construct into an appropriate E. coli expression strain such as BL21(DE3)

  • Grow the transformed cells in suitable medium containing appropriate antibiotics

  • Induce expression with the relevant inducer (e.g., 0.2% arabinose for pBAD vectors or IPTG for T7-based systems)

  • Harvest cells at optimal time point post-induction

Purification Protocol:

  • Disrupt cells by sonication or French press in an appropriate buffer

  • Separate membrane fraction by ultracentrifugation

  • Extract the enzyme from membranes using Triton X-114

  • Purify using chromatographic methods such as DEAE-cellulose chromatography

  • Verify purity by SDS-PAGE (expected band at 46 kDa)

  • Store in Tris/PBS-based buffer, pH 8.0 with 6% Trehalose at -20°C/-80°C

Using this approach, highly active enzyme can be obtained, with membranes from BL21(DE3)/pLR3 showing over 1200 times more cardiolipin synthase activity than comparable membranes from wild-type cells .

What assays are available for measuring cardiolipin synthase activity and how are they performed?

Mixed Micelle Assay:

  • Prepare reaction mixture containing phosphatidyl[2-³H]glycerol as substrate

  • Add purified enzyme or membrane fractions

  • Incubate at optimal temperature (typically 30-37°C)

  • Extract lipids using chloroform-methanol

  • Separate by thin-layer chromatography (TLC)

  • Quantify radioactivity in the cardiolipin spot by scintillation counting

TLC-Based Analysis:

  • Grow bacterial cultures under appropriate conditions

  • Extract total lipids using Bligh-Dyer method

  • Separate phospholipids by TLC

  • Visualize by charring with sulfuric acid or specific phospholipid stains

  • Quantify by densitometry of charred spots

  • For more sensitive analysis, use mass spectrometry (MS) to detect and quantify cardiolipin species

Mass Spectrometry Analysis:

  • Extract total lipids as above

  • Analyze using LC/MS/MS

  • Identify cardiolipin based on characteristic mass-to-charge ratios

  • Quantify relative to internal standards

How can gene knockout or mutation studies be designed to investigate cardiolipin synthase function?

Targeted Gene Disruption Protocol:

  • Clone the cls gene onto a suitable vector (e.g., pBR322 derivative)

  • Disrupt the gene by either:

    • Insertion of an antibiotic resistance gene (e.g., kanamycin resistance)

    • Replacement of the gene with an antibiotic resistance cassette

  • Transform the construct into a recombination-proficient E. coli strain

  • Select for antibiotic-resistant colonies

  • Verify the genomic disruption by:

    • PCR analysis

    • Southern blot hybridization

    • Transductional linkage analysis

  • Confirm the phenotype by measuring:

    • Cardiolipin synthase activity

    • Cardiolipin levels using lipid analysis

    • Growth characteristics compared to wild-type

Complementation Analysis:

  • Transform the cls gene knockout strain with a plasmid carrying the intact cls gene

  • Compare growth characteristics and cardiolipin production between:

    • Wild-type strain

    • cls knockout strain

    • cls knockout strain complemented with plasmid-borne cls gene

  • Vary expression levels using inducible promoters to assess gene dosage effects

Multiple Gene Knockout Strategy:

For studying functional redundancy among cls genes:

  • Create single, double, and triple knockouts of clsA, clsB, and clsC

  • Analyze cardiolipin production in each mutant under various growth conditions

  • Complement with individual cls genes to determine their specific contributions

How do environmental factors affect cardiolipin synthase expression and activity in E. coli?

Cardiolipin synthase expression and activity in E. coli are regulated by multiple environmental factors, creating a complex pattern of cardiolipin production across different growth conditions.

Growth Phase Effects:

  • ClsA activity increases approximately 10-fold when cells enter stationary phase

  • CL levels increase from ~5% in logarithmic phase to ~15% in stationary phase

  • The ΔclsAB mutant still makes CL in stationary phase (via ClsC), indicating growth phase-specific regulation of different cls genes

Osmolarity Effects:

  • All three Cls enzymes show increased activity with increasing medium osmolarity

  • ClsA is the only enzyme contributing detectable levels of CL at low osmolarity during logarithmic growth

  • CL synthesis by all Cls enzymes increases with increasing medium osmolarity during both logarithmic growth and stationary phase

Experimental Approach to Study Environmental Regulation:

  • Culture E. coli under varied conditions:

    • Different growth phases (log, early stationary, late stationary)

    • Various osmolarities (low, moderate, high)

    • Different carbon sources

    • Varied pH conditions

  • Extract lipids and analyze CL content by TLC and/or MS

  • Measure cls gene expression using qRT-PCR with primers specific to each cls gene

  • Use reporter gene fusions (cls promoter-lacZ) to quantify transcriptional responses

  • Analyze protein levels by western blotting with specific antibodies

What is the relationship between YmdB and ClsC, and how does this interaction affect cardiolipin synthesis?

The relationship between YmdB and ClsC represents a unique aspect of cardiolipin synthesis in E. coli. These proteins collaborate in a novel pathway for cardiolipin production that differs mechanistically from the ClsA and ClsB pathways.

Key Experimental Findings:

  • ClsC alone produces only low levels of CL in the stationary phase

  • Co-expression of ClsC with its neighboring gene ymdB results in near wild-type levels of CL

  • The clsC gene is separated by only one base pair from ymdB in the same operon

  • YmdB contains a macro domain with predicted ADP-ribose-binding potential

  • The combined YmdB-ClsC enzyme system uses PE (not PG) as the phosphatidyl donor to PG to form CL, demonstrating a third and unique mechanism for CL synthesis

Experimental Evidence for Interaction:
A series of genetic complementation experiments revealed the nature of the ClsC-YmdB relationship:

  • A triple knockout (ΔclsAB, ΔymdB::KanR) contained reduced levels of CL similar to the ΔclsABC mutant complemented with clsC alone

  • Complementation with only ymdB did not increase CL levels

  • When clsC and ymdB were expressed independently from different but compatible plasmids, CL production was low

  • When co-expressed from the same operon, CL was restored to near wild-type levels

Proposed Interaction Model:

ComponentFunctionSubstrateProduct
ClsCCardiolipin synthasePG + PECL
YmdBADP-ribose binding protein--
ClsC+YmdBEnhanced synthase complexPG + PECL (high yield)

This interaction appears to be essential for efficient cardiolipin synthesis via the PE-dependent pathway, representing a novel mechanism distinct from the PG-PG condensation catalyzed by ClsA and ClsB .

What are the functional differences between E. coli and eukaryotic cardiolipin synthases, and what are their evolutionary implications?

Cardiolipin synthases across prokaryotes and eukaryotes show significant differences in substrate utilization, reaction mechanisms, and protein structure, reflecting their evolutionary divergence while maintaining the essential function of cardiolipin synthesis.

Substrate and Mechanism Differences:

OrganismEnzymeSubstratesMechanism
E. coliClsA/ClsB2 × PGCondensation of two PG molecules
E. coliClsC+YmdBPG + PEUses PE as phosphatidyl donor to PG
EukaryotesCLSPG + CDP-diacylglycerolCDP-alcohol phosphatidyltransferase reaction

The eukaryotic CLS mechanism is fundamentally different, using CDP-diacylglycerol as one substrate rather than condensing two existing phospholipids .

Structural Conservation Analysis:

Sequence alignment studies between prokaryotic and eukaryotic enzymes reveal:

  • Eight amino acid residues of the core CDP-OH-P motif D(X)2DG(X)2AR(X)8-9G(X)3D(X)3D are conserved between PGPSs and CLSs across species

  • Seven amino acids (FxxAxxT) immediately before the core CDP-OH-P motif are highly conserved among PGPSs but not CLSs

  • Four additional amino acid residues are conserved among PGPS but not in CLS

  • These differences in conserved residues likely define the substrate specificity between phosphatidylglycerophosphate synthases (PGPS) and cardiolipin synthases (CLS)

Evolutionary Implications:

The existence of three different cardiolipin synthases in E. coli (ClsA, ClsB, and ClsC) with different catalytic mechanisms suggests evolutionary adaptation to ensure cardiolipin production under varied environmental conditions. The development of the unique PE-dependent pathway (ClsC+YmdB) may represent an adaptation to maintain membrane integrity under specific stress conditions .

The fundamental difference between prokaryotic and eukaryotic CL synthesis pathways reflects the compartmentalization of eukaryotic cells, where cardiolipin synthesis is confined to mitochondria, organelles derived from ancient prokaryotes. This suggests that eukaryotic CLS may have evolved from an ancestral prokaryotic enzyme, adapting to the distinct lipid composition and metabolic requirements of mitochondrial membranes .

What phenotypic changes occur in E. coli strains with cls gene disruptions?

Disruption of cardiolipin synthase genes in E. coli leads to several phenotypic changes, though interestingly, the cells remain viable in most conditions. Here are the key phenotypic changes observed in cls mutants:

Growth Characteristics:

  • Reduced growth rates compared to wild-type strains

  • Lower final culture densities in stationary phase

  • Normal growth restored when a disruptant harbors a plasmid carrying the intact cls gene

Lipid Composition:

  • Undetectable cardiolipin synthase activity in cls disruptants

  • Low but detectable levels of cardiolipin still present, suggesting alternative synthesis pathways

  • Cardiolipin content dependent on the dosage of the pss gene (encoding phosphatidylserine synthase)

  • Unsuccessful attempts to transfer a null allele of cls into a pss-1 mutant, suggesting possible synthetic lethality

Stress Responses:

  • Increased sensitivity to low osmolarity conditions

  • Reduced viability during long-term stationary phase

  • Altered resistance to specific antimicrobial compounds

Cellular Organization:

  • Changes in anionic lipid domains at cell poles and division sites

  • Altered organization of molecular machines responsible for DNA replication and cell division

  • Modified polar localization of specific proteins such as ProP

How does cardiolipin synthesis regulation occur at the enzymatic and genetic levels?

Cardiolipin synthesis in E. coli is regulated through multiple mechanisms at both enzymatic and genetic levels, allowing the bacterium to adjust its membrane composition in response to environmental conditions.

Enzymatic Regulation:

  • Product Inhibition: Cardiolipin synthase is inhibited by its product, cardiolipin, providing negative feedback regulation. This inhibition likely plays an important role in maintaining appropriate cardiolipin levels in E. coli membranes.

  • Phospholipid Modulation:

    • Inhibited by phosphatidate

    • Not inhibited by other anionic phosphoglycerides like phosphatidylinositol and bis-phosphatidate

    • Phosphatidylethanolamine partially counteracts inhibition by cardiolipin but not by phosphatidate

    • Magnesium chloride has opposite effects on these inhibitory interactions

  • Activity Modulation by Growth Phase: ClsA activity increases approximately 10-fold when cells enter stationary phase, contributing to elevated CL levels

Genetic Regulation:

  • Differential Expression: The three cls genes show different expression patterns based on growth conditions:

    • clsA is expressed during both logarithmic and stationary phases

    • clsB and clsC show increased expression in stationary phase

  • Functional Redundancy: The existence of three cardiolipin synthases with overlapping but distinct functions provides a robust system for maintaining cardiolipin production under varied conditions

  • Gene Dosage Effects: Studies with cls gene disruptions have shown that cardiolipin content depends on the dosage of the pss gene, suggesting interaction between phospholipid synthesis pathways

What methodological approaches can resolve contradictory findings in cardiolipin synthase research?

Research on cardiolipin synthase has occasionally produced seemingly contradictory findings regarding its essentiality, enzymatic properties, and cellular functions. Here are methodological approaches to resolve such contradictions:

Resolving Contradictions About Essentiality:

  • Comprehensive Knockout Strategy:

    • Create single, double, and triple knockouts of all cls genes

    • Analyze growth under diverse conditions (temperature, pH, osmolarity, nutrient availability)

    • Monitor long-term survival in stationary phase

    • Assess viability under various stress conditions

  • Genetic Interaction Mapping:

    • Perform synthetic genetic array analysis with cls mutants

    • Identify genetic interactions with other phospholipid synthesis genes

    • Test double mutants (e.g., cls with pss) under various conditions

    • Use conditional alleles for potentially synthetic lethal combinations

  • Quantitative Phenotypic Analysis:

    • Use high-throughput growth curve analysis

    • Measure competitive fitness in mixed cultures

    • Perform long-term evolution experiments with cls mutants

    • Employ microfluidic single-cell analysis to detect subtle growth defects

Resolving Contradictions About Enzymatic Properties:

  • Standardized Assay Conditions:

    • Develop consistent protocols for enzyme purification

    • Standardize reaction conditions (pH, temperature, ionic strength)

    • Use defined substrate preparations

    • Implement multiple detection methods (radiochemical, mass spectrometry)

  • Structure-Function Analysis:

    • Perform site-directed mutagenesis of conserved residues

    • Create chimeric enzymes between different cls genes

    • Express and purify individual domains

    • Conduct comparative analysis across species

  • Protein-Protein Interaction Studies:

    • Investigate potential interactions between different Cls enzymes

    • Analyze the ClsC-YmdB interaction using various methods (co-IP, FRET, crosslinking)

    • Identify additional interaction partners that may modify activity

Experimental Design Table for Resolving Contradictions:

ContradictionMethodological ApproachExpected Outcome
Essentiality of CLGrowth analysis of cls mutants under diverse conditionsIdentification of specific conditions where CL becomes essential
Low CL in cls mutantsMass spectrometry analysis of lipid extractsDetection of alternative CL synthesis pathways
Enzyme activity discrepanciesStandardized in vitro assays with purified componentsConsistent kinetic parameters across laboratories
ClsC-YmdB interactionCo-expression, co-purification, and activity assaysMechanistic understanding of how YmdB enhances ClsC activity

By implementing these rigorous methodological approaches, researchers can resolve contradictions in the literature and develop a more comprehensive understanding of cardiolipin synthase function in E. coli .

What are the potential applications of recombinant E. coli cardiolipin synthase in synthetic biology?

Recombinant E. coli cardiolipin synthase holds significant potential for synthetic biology applications, particularly in membrane engineering and bioproduction systems:

Membrane Engineering:

  • Creation of customized bacterial membranes with altered cardiolipin content for enhanced stress resistance

  • Development of bacteria with optimized membranes for biofuel production or bioremediation

  • Engineering membrane domains with specific lipid compositions for targeted protein localization

  • Design of bacterial cells with improved tolerance to industrial conditions (pH, temperature, solvents)

Bioproduction Systems:

  • Enhancement of membrane protein expression systems through optimal lipid environments

  • Improvement of bacterial cell factories for chemicals requiring membrane transport

  • Development of bacteria with optimized respiratory chains for increased ATP production

  • Creation of strains with extended stationary phase survival for long-term bioproduction processes

Experimental Approach to Synthetic Biology Applications:

  • Express cls genes with various promoters for controlled cardiolipin production

  • Combine with other lipid synthesis genes for designer membrane composition

  • Test engineered strains under industrially relevant conditions

  • Measure production yields and stress tolerance

How might structural studies of cardiolipin synthase inform the development of novel antibacterial agents?

Cardiolipin synthase represents a potential target for novel antibacterial compounds, particularly those targeting multi-drug resistant Gram-negative bacteria. Structural studies would provide crucial insights for drug development:

Structural Analysis Approaches:

  • X-ray crystallography or cryo-EM of purified cardiolipin synthase

  • Molecular dynamics simulations of enzyme-substrate interactions

  • Structure-guided mutagenesis to identify critical catalytic residues

  • Comparative analysis of bacterial versus human CL-synthesizing enzymes

Potential Drug Development Strategies:

  • Design competitive inhibitors targeting the active site

  • Develop allosteric modulators that disrupt enzyme conformation

  • Create compounds that interfere with the ClsC-YmdB interaction

  • Identify molecules that enhance natural product inhibition of the enzyme

Target Validation Framework:

  • Determine whether reduced CL affects pathogen virulence

  • Assess whether cls inhibition synergizes with existing antibiotics

  • Evaluate potential for resistance development

  • Analyze conservation of cls across bacterial pathogens

While complete cls knockouts are viable, the reduced fitness of cls mutants suggests that selective inhibitors could be valuable as antibiotic adjuvants or for targeting bacteria under specific stress conditions .

What emerging technologies could advance our understanding of cardiolipin synthase function in vivo?

Several cutting-edge technologies show promise for revealing new insights into cardiolipin synthase function in living bacterial cells:

Advanced Imaging Technologies:

  • Super-resolution microscopy to visualize cardiolipin domains in bacterial membranes

  • Live-cell imaging with cardiolipin-specific fluorescent probes

  • Correlative light and electron microscopy to link enzyme localization with membrane ultrastructure

  • Single-molecule tracking of tagged cls enzymes to monitor dynamics and interactions

Omics Approaches:

  • Lipidomics to comprehensively analyze membrane composition changes

  • Proteomics to identify cls interaction partners and regulatory proteins

  • Transcriptomics to map cls expression networks under diverse conditions

  • Metabolomics to trace phospholipid precursor flux through different pathways

Genetic Engineering Tools:

  • CRISPR-Cas9 for precise genomic modifications of cls genes

  • Optogenetic control of cls expression for temporal studies

  • Synthetic genetic circuits to modulate cardiolipin production

  • Microfluidic single-cell analysis of cls mutants under dynamic conditions

Integration of Data Through Systems Biology:

  • Mathematical modeling of phospholipid metabolism

  • Network analysis of genetic interactions with cls genes

  • Machine learning approaches to predict cardiolipin function from multi-omics data

  • Computational prediction of cardiolipin-protein interactions

These emerging technologies, especially when applied in combination, have the potential to resolve long-standing questions about cardiolipin synthase function, regulation, and its contribution to bacterial membrane homeostasis and cellular physiology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.