Recombinant Escherichia coli O6:K15:H31 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us; we will prioritize its development.
Synonyms
frdC; ECP_4398; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase is employed during aerobic growth. The FrdC subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: ecp:ECP_4398

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of fumarate reductase subunit C (frdC) in E. coli metabolism?

Fumarate reductase subunit C (frdC) plays a critical role in anaerobic respiration by functioning as one of four essential components of the fumarate reductase complex in E. coli. This complex catalyzes the reduction of fumarate to succinate during anaerobic growth conditions, serving as the terminal electron acceptor in the absence of oxygen. The frdC subunit specifically functions in membrane association of the complete enzyme complex and is required for the oxidation of reduced quinone analogs, thus facilitating electron transfer from the membrane quinone pool to the catalytic site. Without properly functioning frdC, E. coli strains are unable to grow anaerobically on glycerol and fumarate media, highlighting its essential nature in anaerobic energy metabolism. The membrane-anchoring function of frdC is crucial for proper electron transport chain operation under oxygen-limited conditions.

How does frdC interact with other fumarate reductase subunits to form a functional complex?

The functional assembly of the fumarate reductase complex requires precise interactions between all four subunits (FRD A, B, C, and D). Experimental evidence demonstrates that the introduction of all four fumarate reductase subunits into E. coli strains lacking the chromosomal frd operon (such as E. coli MI1443) is essential for restoring anaerobic growth capabilities. While the FRD A and FRD B subunits form a catalytic dimer that shows activity in the benzyl viologen oxidase assay, this dimer alone is insufficient for full biological function. The frdC and frdD subunits serve as membrane anchor proteins, with frdC playing a particularly important role in the proper assembly and membrane association of the entire complex. Notably, when the frdABC and frdD genes are introduced on separate plasmid vectors, anaerobic growth capability is not restored, indicating that the physical proximity of the genes encoding frdC and frdD is critical for proper complex assembly and function. This suggests that co-translation or coordinated expression of these subunits is necessary for correct protein-protein interactions and membrane integration.

What are the structural characteristics of frdC that enable its membrane association function?

The frdC subunit of fumarate reductase contains hydrophobic transmembrane domains that enable its integration into the bacterial cytoplasmic membrane. These hydrophobic regions typically form alpha-helical structures that span the membrane bilayer. The transmembrane orientation of frdC is critical for its function in anchoring the catalytic components (FRD A and FRD B) to the membrane and facilitating interaction with membrane-bound quinones. The proper folding and insertion of frdC into the membrane are essential prerequisites for the assembly of a functional fumarate reductase complex. When expressing recombinant frdC, researchers must account for these structural characteristics by employing expression systems and purification methods compatible with membrane proteins. This may include the use of detergents to maintain protein solubility during isolation or directing expression to the membrane through appropriate signal sequences and expression conditions that prevent the formation of inclusion bodies.

Which expression systems are most effective for producing recombinant frdC in E. coli?

The optimal expression system for recombinant frdC production depends on several factors including the desired yield, purity, and downstream applications. For membrane proteins like frdC, specialized expression systems that allow precise control over expression rates are particularly valuable. Temperature-inducible promoters such as the λcI 857 system can be effective, as they allow cultures to grow at 28-30°C until reaching the desired density before induction at 40-42°C. Alternatively, cold-inducible promoters like cspA (as found in the pCold series of plasmids) can be advantageous since expression at lower temperatures (15°C) often improves membrane protein folding and reduces inclusion body formation. The selection of an appropriate vector backbone (such as pUC derivatives) with compatible origins of replication and antibiotic resistance markers is also crucial. When expressing membrane proteins like frdC, it's often beneficial to use expression strains specifically engineered for membrane protein production, such as C41(DE3) and C43(DE3), which contain mutations in the lacUV5 promoter that reduce T7 RNA polymerase levels and prevent cell death during expression of potentially toxic membrane proteins.

What strategies can be employed to optimize the solubility of recombinant frdC during expression?

Optimizing the solubility of membrane proteins like frdC presents unique challenges compared to soluble proteins. Several approaches can significantly improve results:

  • Temperature modulation: Lowering the expression temperature to 15-20°C using cold-inducible promoters can slow protein synthesis, allowing more time for proper membrane insertion and reducing aggregation.

  • Fusion tags selection: Strategic use of fusion tags can enhance membrane protein solubility. For frdC, consider:

    • His-tags for purification by immobilized metal affinity chromatography

    • Specialized fusion partners designed for membrane proteins

  • Periplasmic targeting: Directing frdC to the periplasm using appropriate signal sequences (such as DsbA) via the SRP pathway can improve membrane integration.

  • Induction optimization: Inducing expression at early stationary phase rather than mid-log phase can result in slower protein synthesis rates, potentially improving membrane insertion efficiency.

  • Media supplementation: Including glycerol (0.5-2%) and specific membrane-stabilizing agents in the growth media can support membrane protein folding.

The choice between these strategies should be determined through small-scale expression trials before scaling up production. The ideal approach often involves combining multiple methods, such as using a low-temperature induction system with appropriate fusion tags and optimized media composition.

What purification protocols are most suitable for isolating biologically active recombinant frdC?

Purifying membrane proteins like frdC while maintaining their biological activity requires specialized protocols that preserve the native membrane environment or substitute it with suitable detergents. A methodological approach includes:

  • Membrane fraction isolation: Following cell lysis (typically by sonication or French press), differential centrifugation is used to isolate the membrane fraction containing frdC.

  • Detergent solubilization: Carefully selected detergents (e.g., n-dodecyl-β-D-maltoside, digitonin, or CHAPS) at optimized concentrations solubilize frdC while preserving its structure. This step typically requires empirical testing of multiple detergents.

  • Affinity chromatography: If frdC is expressed with an affinity tag (e.g., His-tag), immobilized metal affinity chromatography with Ni-NTA resin can be employed, maintaining detergent above critical micelle concentration in all buffers.

  • Size exclusion chromatography: This step separates properly folded frdC from aggregates and removes detergent micelles.

  • Activity verification: Assessing quinone oxidation activity confirms that purified frdC retains its biological function.

Throughout purification, it's essential to maintain appropriate temperature (usually 4°C), pH, and ionic strength conditions to prevent protein denaturation. The choice of detergent is particularly critical, as it must effectively extract frdC from the membrane while maintaining its native conformation and activity.

How can researchers verify the proper membrane integration of recombinant frdC?

Verifying proper membrane integration of recombinant frdC requires multiple complementary approaches:

  • Subcellular fractionation: Separate cytoplasmic, periplasmic, and membrane fractions through differential centrifugation and analyze by Western blot using antibodies against frdC or its fusion tag. Properly integrated frdC will predominantly appear in the membrane fraction.

  • Protease accessibility assays: Treat intact bacterial cells or isolated membrane vesicles with proteases that cannot penetrate the membrane. Properly oriented frdC will show differential protease susceptibility patterns depending on which domains are exposed.

  • Functional complementation: Introduce the recombinant frdC into a strain lacking the chromosomal frd operon (such as E. coli MI1443) and test for restoration of anaerobic growth on glycerol and fumarate. Successful growth indicates functional membrane integration.

  • Fluorescence microscopy: Express frdC fused to a fluorescent protein and observe its cellular localization through fluorescence microscopy. Membrane-integrated frdC will show peripheral fluorescence patterns consistent with membrane localization.

  • Activity assays: Measure quinone oxidation activity in isolated membrane fractions, as proper membrane integration is required for this function of frdC.

The most definitive verification comes from combining these approaches, particularly correlating localization with functional activity, to confirm that frdC is not only present in the membrane fraction but also correctly folded and oriented.

What experimental controls are critical when studying recombinant frdC expression and function?

When studying recombinant frdC, implementing rigorous controls is essential for valid data interpretation:

  • Empty vector control: Cells transformed with the expression vector lacking the frdC gene help distinguish between effects caused by the vector itself versus the recombinant protein.

  • Inactive mutant control: Express a site-directed mutant of frdC with alterations in key functional residues to differentiate between specific and non-specific effects.

  • Non-induced control: Maintain a parallel culture without inducer addition to assess leaky expression and baseline cellular characteristics.

  • Wild-type fumarate reductase complex: Include the naturally expressed complex as a positive control for activity assays and assembly studies.

  • Strain background control: Test expression in multiple E. coli strains, including those specifically designed for membrane protein expression (C41/C43(DE3)) versus standard strains.

  • Temporal controls: Sample at multiple time points post-induction to track expression kinetics and potential degradation.

  • Environmental controls: Maintain precise control of growth conditions (temperature, pH, aeration) between experiments to ensure reproducibility.

These controls help disambiguate the effects of the recombinant frdC from background factors and establish the specificity of observed phenotypes and biochemical activities.

How can researchers assess the impact of frdC mutations on fumarate reductase assembly and function?

Assessing the impact of frdC mutations requires a multifaceted approach that examines both assembly and function:

  • Complementation assays: Transform frdC mutants into E. coli MI1443 (lacking chromosomal frd operon) and measure growth rates under anaerobic conditions with glycerol and fumarate. Quantify growth curves to detect subtle differences in complementation efficiency.

  • Complex assembly analysis: Use blue native PAGE or size exclusion chromatography to determine if mutant frdC properly incorporates into the complete fumarate reductase complex.

  • Membrane association quantification: Perform subcellular fractionation and quantify the proportion of FRD A and FRD B subunits associated with the membrane fraction when co-expressed with mutant versus wild-type frdC.

  • Electron transfer measurements: Measure the rate of quinone analog oxidation in membrane preparations containing mutant frdC to assess functional electron transfer.

  • Protein-protein interaction studies: Employ techniques such as bacterial two-hybrid systems or co-immunoprecipitation to quantify interactions between mutant frdC and other fumarate reductase subunits.

  • Stability assessment: Determine the half-life of the assembled complex containing mutant frdC compared to wild-type through pulse-chase experiments.

This comprehensive analysis allows researchers to distinguish between mutations that affect protein folding, membrane insertion, subunit interaction, or catalytic function, providing mechanistic insights into frdC's role in the fumarate reductase complex.

How does the frdC gene in E. coli O6:K15:H31 compare with other pathogenic and non-pathogenic E. coli strains?

Comparative genomic analysis reveals important insights about frdC conservation and variation across E. coli strains:

Uropathogenic E. coli (UPEC) strain 536 (O6:K15:H31) serves as a model organism for extraintestinal pathogenic E. coli (ExPEC). When comparing its genome with other strains, several patterns emerge regarding the frd operon and specifically frdC:

  • Core genome membership: The frd operon, including frdC, generally belongs to the core genome of E. coli, present in both pathogenic and non-pathogenic strains, reflecting its fundamental role in energy metabolism.

  • Sequence conservation: High sequence conservation of frdC is typically observed between strains, with variations primarily in non-catalytic regions. This conservation reflects the essential nature of anaerobic respiration.

  • Genomic context: In UPEC strain 536, the genomic context surrounding the frd operon may differ from non-pathogenic strains like K-12 MG1655, potentially affecting regulation.

  • Expression patterns: While the gene itself is conserved, expression patterns of frdC may differ between pathogenic and non-pathogenic strains, particularly in response to environmental conditions encountered during infection.

  • Regulatory differences: UPEC strains show unique regulation of anaerobic metabolism genes, potentially enhancing their fitness during urinary tract infections where oxygen availability fluctuates.

These comparative analyses help understand how core metabolic functions may be adapted or regulated differently in pathogenic strains, potentially contributing to their virulence and adaptability in host environments.

What role does frdC play in the pathogenicity and metabolic adaptation of uropathogenic E. coli?

The frdC subunit contributes to UPEC pathogenicity through several interconnected mechanisms:

  • Anaerobic adaptation: During urinary tract infections, UPEC encounters oxygen-limited microenvironments where fumarate reductase activity becomes essential for energy generation. The frdC subunit, by enabling proper membrane association and electron transfer, allows UPEC to thrive under these anaerobic conditions.

  • Metabolic flexibility: The ability to use alternative electron acceptors like fumarate provides UPEC with metabolic flexibility to adapt to changing conditions within the host. This adaptation is particularly important as UPEC transitions between different niches during infection progression.

  • Persistence support: Anaerobic metabolism supported by functional fumarate reductase may contribute to UPEC persistence within biofilms and intracellular bacterial communities, where oxygen availability is limited.

  • Indirect virulence enhancement: While not a classical virulence factor, frdC indirectly supports virulence by enabling metabolic activity under conditions where strict aerobes would be at a disadvantage.

  • Potential therapeutic target: The essential nature of frdC for anaerobic growth makes the fumarate reductase complex a potential target for therapeutic interventions that could specifically inhibit UPEC metabolism during infection.

How can recombinant frdC be utilized in structural biology studies of membrane protein complexes?

Recombinant frdC offers valuable opportunities for advancing structural biology of membrane protein complexes:

  • Protein engineering for structural studies:

    • Incorporation of purification tags at positions that don't interfere with membrane insertion

    • Introduction of specific amino acids for site-directed spin labeling or chemical modification

    • Creation of truncated or chimeric constructs to identify minimal functional domains

  • Crystallography optimization strategies:

    • Co-expression with other fumarate reductase subunits to form stable complexes

    • Use of lipidic cubic phase methodology for membrane protein crystallization

    • Fusion with crystallization chaperones to provide crystal contacts

  • Cryo-EM applications:

    • Expression of frdC within the complete fumarate reductase complex for single-particle analysis

    • Incorporation into nanodiscs to mimic native membrane environment

    • Use of specially designed detergents that preserve native-like conformations

  • NMR spectroscopy approaches:

    • Selective isotopic labeling of frdC when expressed within the complete complex

    • Solid-state NMR studies of membrane-embedded complexes

    • Solution NMR of detergent-solubilized preparations for dynamic studies

  • Computational integration:

    • Molecular dynamics simulations to study frdC movement within membranes

    • Integration of experimental constraints from multiple methods to refine structural models

These approaches have collectively advanced our understanding of membrane protein structure and function, with recombinant systems providing the necessary quantities of protein for comprehensive structural biology investigations.

What strategies can address poor expression or toxicity issues when working with recombinant frdC?

When encountering poor expression or toxicity with recombinant frdC, researchers can implement these targeted solutions:

ProblemSolution StrategyMechanismImplementation Details
Toxic basal expressionTighter promoter controlReduces leaky expressionUse pLysS strains containing T7 lysozyme; glucose repression (0.5-1%)
Protein toxicitySpecialized expression strainsMutations that tolerate toxic proteinsC41(DE3) and C43(DE3) strains with mutations in lacUV5 promoter
Low expression levelsCodon optimizationMatches host codon usageOptimize frdC codons for E. coli; remove rare codons
Cell death after inductionSecretion strategiesRemoves protein from cytoplasmDsbA signal sequence for SRP pathway targeting
Growth inhibitionControlled inductionBalances expression and growthLower inducer concentrations; pulse induction strategy
Inclusion body formationExpression temperatureSlows folding, improves membrane insertionReduce to 15-20°C during induction phase
Unstable mRNA5' UTR optimizationImproves translation initiationIncorporate stabilizing elements; optimize Shine-Dalgarno sequence

For recombinant frdC specifically, using specialized strains like C41(DE3) combined with low-temperature induction and careful optimization of induction timing generally yields the best results. The implementation of these strategies should be systematic, testing one variable at a time in small-scale cultures before proceeding to larger volumes.

What analytical techniques are most informative for troubleshooting frdC membrane integration issues?

When investigating membrane integration issues with recombinant frdC, researchers should employ a combination of analytical techniques:

  • Western blotting with subcellular fractionation: Separate cytoplasmic, periplasmic, and membrane fractions through differential centrifugation and analyze frdC distribution. Properly integrated frdC should predominantly localize to the membrane fraction, while integration issues may result in cytoplasmic accumulation or inclusion body formation.

  • Detergent extraction profiling: Systematically test multiple detergents (mild to harsh) for their ability to extract frdC from membranes. Integration problems often manifest as either resistance to extraction (indicating aggregation) or extraction with very mild detergents (suggesting peripheral rather than integral association).

  • Protease protection assays: Treat intact cells or membrane vesicles with proteases under conditions where only exposed domains are accessible. Compare proteolytic fragment patterns with those predicted from the known or modeled topology of properly inserted frdC.

  • Fluorescence microscopy with fusion proteins: Visualize cellular localization of frdC-fluorescent protein fusions. Misfolded or improperly integrated proteins typically form inclusion bodies visible as discrete fluorescent foci, while properly integrated proteins show membrane-associated fluorescence.

  • Mass spectrometry of crosslinked products: Use membrane-impermeable crosslinkers to identify interaction partners of frdC. Proper integration should result in crosslinks to other membrane proteins and lipids.

  • Circular dichroism spectroscopy: Analyze secondary structure content of purified frdC to determine if it contains the expected alpha-helical content characteristic of properly folded membrane proteins.

By combining these approaches, researchers can pinpoint specific issues in the membrane integration process and refine expression conditions accordingly.

How can researchers optimize conditions for co-expression of all fumarate reductase subunits to obtain the functional complex?

Successful co-expression of all fumarate reductase subunits requires careful optimization of several parameters:

  • Vector design strategies:

    • Single polycistronic vector containing all four genes (frdABCD) in their natural order with optimized spacing between genes

    • Dual vector system with compatible origins and different antibiotic selection markers

    • Use of balanced promoters to ensure proper stoichiometry of subunits

  • Expression strain selection:

    • C41(DE3) and C43(DE3) strains specifically developed for membrane protein complexes

    • BL21 derivatives with enhanced membrane protein expression capabilities

    • Strains with reduced protease activity to minimize degradation

  • Induction optimization:

    • Temperature reduction to 16-20°C upon induction

    • Inducer concentration titration to find optimal expression level

    • Extended expression time (24-48 hours) at lower temperatures

  • Media composition adjustments:

    • Supplementation with iron source to support synthesis of iron-sulfur clusters in FRD B

    • Addition of glucose or glycerol as carbon sources

    • Use of terrific broth or other rich media for higher biomass

  • Post-induction environmental control:

    • Shift to microaerobic or anaerobic conditions to mimic natural expression environment

    • Reduced shaking speed to prevent shearing of membrane structures

    • pH control to optimize complex assembly

Experimental evidence indicates that expression of the complete frd operon from a single vector under the control of a moderately strong promoter, in C41(DE3) cells, with induction at OD600 of 0.6-0.8 followed by temperature reduction to 18°C for 16-20 hours produces the highest yield of functional complex. This approach ensures proper stoichiometry and co-localization of all subunits during translation, which is critical for correct assembly.

How should researchers interpret activity assays when comparing wild-type and recombinant fumarate reductase complexes?

When comparing wild-type and recombinant fumarate reductase complexes, proper interpretation of activity assays requires consideration of several factors:

  • Baseline normalization: Activity measurements should be normalized to either protein concentration or membrane content to enable direct comparison between samples. For membrane-bound complexes like fumarate reductase, normalization to total membrane protein is often most appropriate.

  • Substrate saturation verification: Ensure measurements are performed at saturating substrate concentrations (both fumarate and reduced quinones) to determine true Vmax differences rather than apparent differences due to varying substrate affinities.

  • Rate linearity assessment: Verify that reaction rates are linear with respect to time and enzyme concentration under the conditions used, as recombinant preparations may exhibit different stability characteristics.

  • Multiple activity metrics: Compare activities using both specific (benzyl viologen oxidase assay) and physiological (quinone analog oxidation) electron donors to distinguish between defects in catalytic activity versus electron transfer through frdC.

  • Controls for membrane integrity: Include controls that assess membrane integrity and energization state, as these factors can significantly influence the activity of membrane-bound enzymes.

  • Statistical analysis: Apply appropriate statistical tests (typically t-tests or ANOVA) when comparing multiple preparations, with sufficient biological replicates (n≥3) to account for preparation-to-preparation variability.

  • Complementation correlation: Correlate in vitro activity measurements with in vivo complementation efficiency to establish physiological relevance of observed activity differences.

What bioinformatic approaches can be used to analyze the evolutionary conservation of frdC across bacterial species?

Comprehensive bioinformatic analysis of frdC evolutionary conservation can employ these methodological approaches:

  • Sequence homology analysis:

    • BLAST searches against comprehensive databases to identify homologs

    • Construction of multiple sequence alignments using MUSCLE, CLUSTAL, or T-Coffee

    • Calculation of conservation scores at each amino acid position

    • Visualization of conservation patterns using sequence logos

  • Phylogenetic analysis:

    • Maximum likelihood tree construction using RAxML or IQ-TREE

    • Bayesian phylogenetic inference with MrBayes

    • Reconciliation of gene trees with species trees to identify horizontal gene transfer events

    • Ancestral sequence reconstruction to infer evolutionary trajectories

  • Structural conservation mapping:

    • Homology modeling of frdC structure in different species

    • Mapping conservation scores onto 3D structure models

    • Identification of structurally conserved regions versus variable regions

    • Correlation of conservation with functional domains and membrane-spanning regions

  • Coevolution analysis:

    • Detection of coevolving residues within frdC using mutual information or direct coupling analysis

    • Identification of coevolution between frdC and other fumarate reductase subunits

    • Prediction of critical interaction interfaces based on coevolutionary signals

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify positions under purifying or positive selection

    • Branch-site models to detect episodic selection in specific lineages

    • Sliding window analysis to identify domains under different selection pressures

These approaches collectively provide insights into functionally critical regions of frdC, evolutionary constraints on membrane protein structure, and adaptation patterns across diverse bacterial metabolic strategies.

How can researchers differentiate between direct effects of frdC mutation and indirect effects on the entire fumarate reductase complex?

Differentiating direct versus indirect effects of frdC mutations requires a systematic investigative approach:

  • Structural-functional correlation:

    • Map mutations onto structural models to identify if they directly affect membrane anchoring, quinone binding, or subunit interaction sites

    • Compare effects of mutations in different functional domains to establish structure-function relationships

  • Isolated component studies:

    • Express and purify individual components (FRD A+B dimer, FRD C, FRD D) and reconstitute in different combinations

    • Measure the binding affinity between mutant frdC and other subunits using techniques like isothermal titration calorimetry or surface plasmon resonance

    • Assess membrane insertion efficiency of mutant frdC independent of other subunits

  • Genetic complementation analysis:

    • Perform cross-complementation studies with chimeric constructs where parts of frdC are swapped with homologous regions

    • Use suppressor mutation screens to identify compensatory changes in other subunits that restore function

    • Apply conditional expression systems to temporally separate frdC expression from complex assembly

  • Biochemical dissection:

    • Compare effects of mutations on different biochemical activities (e.g., fumarate reduction versus quinone oxidation)

    • Measure the impact on membrane potential or proton translocation to assess coupling efficiency

    • Analyze the differential effects of inhibitors that target different parts of the complex

  • In vivo versus in vitro comparison:

    • Compare the severity of effects in cell-based complementation assays versus purified protein assays

    • Assess the stability of the complex in cellular membranes versus reconstituted systems with mutant frdC

This multifaceted approach allows researchers to distinguish between direct effects (e.g., disruption of quinone binding by frdC) versus indirect effects (e.g., destabilization of the entire complex due to improper membrane anchoring), providing mechanistic insights into frdC function.

What emerging technologies could advance our understanding of frdC structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of frdC structure-function relationships:

  • Cryo-electron tomography: This technique can visualize the fumarate reductase complex directly within the native membrane environment, potentially revealing how frdC orients and influences the organization of the entire complex without artifacts introduced by detergent extraction.

  • Single-molecule FRET: By introducing fluorescent labels at strategic positions within frdC and other subunits, researchers can monitor real-time conformational changes during catalysis, providing insights into the dynamic aspects of complex assembly and function that are invisible to static structural methods.

  • Nanopore recording: This emerging technique could potentially assess the ion conductance properties of reconstituted frdC in artificial membranes, offering insights into whether frdC contributes to proton movement during the catalytic cycle.

  • In-cell NMR spectroscopy: This approach allows observation of protein structure and dynamics within living E. coli cells, potentially revealing how the native cellular environment influences frdC folding and interactions.

  • AIphaFold and related deep learning approaches: These computational methods can predict frdC structure with unprecedented accuracy and, when combined with molecular dynamics simulations, can model the membrane-embedded complex in different functional states.

  • Genome-wide CRISPR screens: Such screens can identify previously unknown genetic interactions with frdC, potentially revealing unexpected cellular pathways that influence fumarate reductase function.

  • Proximity labeling proteomics: Techniques like BioID or APEX when fused to frdC can identify the complete interactome of the protein in living cells, potentially discovering new interaction partners beyond the known complex components.

How might structural insights from frdC research contribute to the development of novel antimicrobial strategies?

Structural insights from frdC research offer promising avenues for antimicrobial development:

  • Quinone binding site targeting: Detailed structural information about how frdC interacts with quinones could enable the design of competitive inhibitors that specifically block electron transfer to the fumarate reductase complex, disrupting anaerobic energy metabolism in pathogens.

  • Complex assembly interference: Understanding the protein-protein interaction interfaces between frdC and other fumarate reductase subunits could lead to the development of peptide-based or small molecule inhibitors that prevent complex assembly without affecting host proteins.

  • Membrane insertion disruption: Structural details of how frdC integrates into the bacterial membrane could inform the design of compounds that interfere with this process, potentially destabilizing the entire complex.

  • Pathogen-specific features exploitation: Comparative structural analysis between pathogenic and commensal E. coli strains might reveal subtle differences in frdC that could be exploited for selective targeting.

  • Combination therapy rationale: Structural insights might identify synergistic vulnerabilities when fumarate reductase inhibition is combined with other antimicrobial mechanisms, leading to more effective treatment strategies.

  • Drug delivery approaches: Understanding the topology and accessibility of different regions of frdC within the membrane could inform the design of drug delivery systems that effectively target membrane-embedded enzymes.

  • Biofilm disruption strategies: Since anaerobic metabolism is often critical in biofilm environments, structural insights into frdC function could lead to strategies that specifically disrupt biofilm formation or maintenance.

These approaches are particularly valuable because they target bacterial energy metabolism pathways that are distinct from those in human cells, potentially offering selective toxicity with reduced side effects compared to broader-spectrum antibiotics.

What computational models best predict the impact of mutations on frdC function and complex assembly?

Advanced computational modeling approaches offer increasingly accurate predictions of mutation effects on frdC:

  • Molecular dynamics simulations:

    • All-atom simulations with explicit membrane and solvent can model how mutations affect frdC stability within the lipid bilayer

    • Coarse-grained models allow longer timescale simulations to capture larger conformational changes

    • Free energy calculations can quantify the energetic impact of mutations on membrane insertion

  • Protein-protein docking models:

    • HADDOCK or Rosetta docking to predict how mutations at interfaces affect complex assembly

    • Molecular mechanics/Poisson-Boltzmann surface area (MM/PBSA) calculations to estimate binding free energy changes

  • Machine learning approaches:

    • Deep neural networks trained on experimental mutation datasets can predict stability changes

    • Graph-based models that capture the network of atomic interactions disrupted by mutations

    • Sequence-based predictors that leverage evolutionary conservation patterns

  • Quantum mechanical calculations:

    • QM/MM methods for mutations affecting electron transfer pathways through frdC

    • Electronic structure calculations for mutations in quinone binding sites

  • Integrative modeling frameworks:

    • Combine experimental data (crosslinking, mass spectrometry, FRET) with computational models

    • Ensemble modeling to capture the distribution of possible structural states

The most successful predictive models typically integrate multiple approaches, combining physics-based simulations with machine learning and evolutionary information. For membrane proteins like frdC, models that explicitly account for the lipid environment and consider the unique constraints of membrane insertion show the highest accuracy in predicting mutation effects. These comprehensive models can guide experimental design by prioritizing mutations most likely to yield informative phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.