Recombinant Escherichia coli O6:K15:H31 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O6:K15:H31 Fumarate Reductase Subunit D (FrdD)

Escherichia coli ( E. coli) strains have two distinct membrane-bound enzymes containing flavin adenine dinucleotide (FAD) that facilitate the interconversion of fumarate and succinate . Fumarate reductase, which includes the subunit D (FrdD), functions during anaerobic growth, whereas succinate dehydrogenase functions during aerobic growth. Fumarate reductase (QFR) is a membrane-bound flavoprotein that catalyzes the reduction of fumarate to succinate in anaerobic conditions .

QFR is essential for anaerobic growth on glycerol, lactate, or formate when fumarate serves as the terminal electron acceptor, and for anaerobic dihydrogen-dependent growth with fumarate . Menaquinone is the obligatory electron donor .

Structure and Function of Fumarate Reductase Subunits

Fumarate reductase is composed of four subunits: FrdA, FrdB, FrdC, and FrdD . The complex has a cytoplasmic catalytic domain (FrdAB) containing a bound flavin cofactor and iron-sulfur clusters, as well as a membrane anchor domain (FrdCD) containing the quinol binding site(s) . All four subunits are essential for anaerobic growth on glycerol and fumarate .

  • FrdA FrdA is one of two catalytic subunits in the fumarate reductase complex and contains the FAD cofactor .

  • FrdB FrdB is the second catalytic subunit and contains 11 cysteine residues arranged in three clusters predicted to form iron-sulfur clusters, including a 4Fe-4S, a 3Fe-4S, and a 2Fe-2S cluster .

  • FrdC FrdC is one of two integral membrane proteins in the fumarate reductase complex .

  • FrdD FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones . It is also one of two integral membrane proteins in the fumarate reductase complex .

FrdC and FrdD each have three transmembrane helices connected by periplasmic loops, with the N-terminus located in the cytoplasm and the C-terminus in the periplasm, positioned to form two menaquinone-binding pockets . Despite similar function, hydrophobicity, and protein size, FrdC and FrdD do not share significant sequence identity with the corresponding membrane-binding subunits of succinate dehydrogenase, SdhC and SdhD .

Functional Significance and Interactions

FrdD is involved in several pathways and interacts directly with proteins and molecules, as detected by methods such as yeast two-hybrid, co-IP, and pull-down assays . Both FrdC and FrdD are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues . Separating the DNA coding for FrdC and FrdD affects the ability of fumarate reductase to assemble into a functional complex .

Homology and Interchangeability

QFR is structurally and functionally homologous to succinate dehydrogenase (SQR), which catalyzes the oxidation of succinate to fumarate under aerobic conditions . The functions of QFR and SQR are partially interchangeable; a plasmid containing the frd genes can compensate for the growth deficiency of an sdh mutant, while anaerobic expression of succinate dehydrogenase supports the growth of an frd mutant .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; ECP_4397; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions during aerobic growth. The FrdD subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: ecp:ECP_4397

Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural and functional role of Fumarate reductase subunit D (frdD) in E. coli O6:K15:H31?

Fumarate reductase subunit D (frdD) is a critical component of the membrane-bound fumarate reductase complex in E. coli O6:K15:H31 (strain 536), which functions in anaerobic respiration. This 13 kDa hydrophobic protein contains 119 amino acids and serves as one of the membrane anchor subunits of the FrdABCD complex. The FrdABCD complex catalyzes the reduction of fumarate to succinate, allowing E. coli to utilize fumarate as a terminal electron acceptor during anaerobic growth when oxygen and nitrate are unavailable .

Structurally, frdD works alongside frdC as an anchor subunit, attaching the catalytic subunit (FrdA) and the iron-sulfur subunit (FrdB) to the cell membrane. The membrane-anchoring function is critical for positioning the enzyme within the cell's respiratory chain. FrdC and FrdD accept electrons from quinols (specifically menaquinol in E. coli) and transfer them to FrdB, which then transfers them to FrdA, where fumarate is reduced to succinate .

  • How is the expression of the frdABCD operon regulated in E. coli O6:K15:H31?

The expression of the frdABCD operon in E. coli O6:K15:H31 is tightly regulated at the transcriptional level in response to environmental conditions, particularly the availability of terminal electron acceptors:

  • Oxygen regulation: Expression increases approximately 10-fold during anaerobic growth compared to aerobic conditions .

  • Fumarate induction: The presence of fumarate, the substrate, increases expression by an additional 1.5-fold .

  • Nitrate repression: Nitrate, a preferred electron acceptor, decreases expression by about 23-fold .

This regulation involves several molecular mechanisms:

  • FNR protein: The FNR (fumarate and nitrate reduction) regulatory protein is primarily responsible for anaerobic activation of frd operon expression. In fnr mutants, anaerobic induction is impaired and can be restored when the fnr+ gene is provided in trans .

  • Transcriptional control: The frd mRNA transcript initiates with an adenine residue 93 bases prior to the start of frdA translation and terminates in a uridine-rich region centered at 46 bases after the last codon of frdD .

  • Termination structure: A stem and loop structure serves the dual role of an frd terminator under anaerobic conditions and an ampC attenuator under aerobic conditions .

  • What are the biochemical characteristics of fumarate reductase activity in E. coli?

Fumarate reductase in E. coli exhibits specific biochemical properties that are important for researchers to consider:

  • Reaction catalyzed: FRD reduces fumarate to succinate using two electrons, typically supplied by quinol, FADH2/FMNH2, or NADH .

  • Enzyme kinetics: Standard assay conditions for measuring FRD activity include:

    • Buffer: 50 mM NaPO4 (pH 6.5)

    • Substrate: 20 mM fumarate

    • Electron donor: 0.2 mM NADH

    • Temperature: Often performed at 70°C under anaerobic (Ar gas) conditions

    • Measurement: Decrease in NADH monitored at 340 nm

  • Km values: For accurate kinetic analysis, researchers typically test:

    • Fumarate concentrations: 0.01 to 20 mM

    • NADH concentrations: 0.03 to 0.2 mM

  • Alternative electron donors: The enzyme can also accept electrons from:

    • FADH2 (0.25 mM FAD reduced with dithionite)

    • FMNH2 (0.25 mM FMN reduced with dithionite)

    • Reduced methyl viologen (5 mM MV)

    • Reduced benzyl viologen (10 mM BV)

  • How does the FrdD subunit contribute to quinone binding in the fumarate reductase complex?

The FrdD subunit plays a crucial role in defining the proximal menaquinol (MQH2) binding site (QP) of E. coli fumarate reductase. Based on fluorescence quench (FQ) titrations and site-directed mutagenesis studies:

  • FrdD contributes to forming the quinone binding pocket along with FrdB and FrdC .

  • The H80 residue in FrdD is particularly important for quinone binding; the FrdD-H80K mutation significantly increases the apparent Kd value for HOQNO (a menaquinol analog) from 2.5 nm to 20 nm .

  • The QP site is the sole high-affinity quinone binding site in the FrdABCD complex, as evidenced by monophasic binding in fluorescence quench titrations .

  • Mutations affecting HOQNO binding generally correlate with effects on the observed Km and kcat values for fumarate-dependent quinol oxidation, highlighting the functional importance of proper quinone binding for enzyme activity .

Advanced Research Questions

  • What methodologies are effective for heterologous expression of recombinant E. coli O6:K15:H31 frdD?

For effective heterologous expression of recombinant E. coli O6:K15:H31 frdD, several methodological considerations are critical:

Expression system optimization:

  • Promoter selection: T7 expression systems with arabinose-inducible promoters (PBAD) show lower insoluble protein fractions compared to trc or tac promoters, which is crucial for membrane proteins like frdD .

  • Induction conditions: Using lower inducer concentrations (0.015% arabinose instead of 0.2%) with glucose as carbon source provides finer control over expression levels, helping prevent protein aggregation .

  • Carbon source: Glycerol as a carbon source typically yields higher protein expression levels compared to glucose, but glucose can help "dampen" expression when precise control is needed .

Monitoring and validation approaches:

  • Flow cytometry (FCM): Can be used to rapidly assess protein expression by fusing GFP to frdD. This method correlates well with soluble protein content determined by SDS-PAGE but is much faster (5-10 minutes versus hours) .

  • Solubility assessment: Determine soluble/insoluble fractions through SDS-PAGE and densitometric analysis. For membrane proteins like frdD, detergent screening is essential for extraction and maintaining native conformation .

  • Fluorescence quench titrations: Can be used to confirm proper folding and function of frdD by assessing binding of quinone analogs like HOQNO .

Temperature and expression kinetics:

  • Growth at lower temperatures (typically 25-30°C versus 37°C) allows slower protein production, improving membrane insertion and proper folding of hydrophobic proteins like frdD .

  • Extended induction times at lower temperatures may yield better results than short, high-intensity expression.

  • How can site-directed mutagenesis be applied to study the functional domains of frdD in fumarate reductase activity?

Site-directed mutagenesis is a powerful approach for understanding the structure-function relationship of frdD in the fumarate reductase complex:

Key residues for mutation studies:

  • FrdD-H80: Mutation to lysine (FrdD-H80K) significantly impacts quinone binding, as shown by increasing the apparent Kd for HOQNO from 2.5 nm to 20 nm. This residue is critical for proper interaction with the quinone substrate .

  • Transmembrane helices: The hydrophobic regions that anchor the protein in the membrane can be systematically mutated to determine their role in membrane insertion and complex assembly.

  • Interface residues: Amino acids at the interface with other subunits (particularly FrdC) can be mutated to study subunit interactions.

Methodological approach:

  • Primer design: Design overlapping primers containing the desired mutation following standard protocols for site-directed mutagenesis.

  • PCR amplification: Use high-fidelity polymerase to minimize unwanted mutations.

  • DpnI digestion: To remove methylated template DNA.

  • Transformation: Into competent E. coli cells.

  • Sequence verification: Confirm successful mutagenesis.

Functional analyses of mutants:

  • Fluorescence quench titrations: To measure quinone binding affinity (Kd) of the mutant protein .

  • EPR spectroscopy: To detect bound menasemiquinone radicals and assess electron transfer capability .

  • Steady-state kinetics: Measure fumarate-dependent quinol oxidation to determine Km and kcat values of the mutant proteins .

  • Membrane potential measurements: To assess the impact of mutations on proton translocation.

  • What approaches can be used to investigate the role of frdD in electron transfer within the fumarate reductase complex?

Investigating the role of frdD in electron transfer requires sophisticated biophysical and biochemical approaches:

Spectroscopic techniques:

  • EPR spectroscopy: Essential for detecting and characterizing paramagnetic species such as menasemiquinone radicals formed during electron transfer. EPR can detect when electrons are trapped at specific sites in the electron transport chain, such as the case with the FrdC-E29L mutant where only one electron is removed from menaquinol, resulting in a trapped menasemiquinone radical anion .

  • Fluorescence spectroscopy: Using fluorescence quench titrations with quinone analogs like HOQNO to measure binding affinity and assess the integrity of the quinone binding site .

Electrochemical approaches:

  • Bioelectrochemical reactors: Systems where electrons can be delivered directly to cells from a cathode. These have shown that the Mtr pathway can deliver cathodic electrons via native fumarate reductases to fumarate, with FrdABCD being responsible for approximately 60% of the current consumption .

  • Cyclic voltammetry: To determine the redox potential of the fumarate reductase complex and its components. The catalytic wave for fumarate reduction starts at approximately -43 mV vs. Ag/AgCl, close to the redox potential of FrdAB .

Genetic manipulation:

  • Knockout studies: Comparing current consumption by wild-type, ΔfrdABCD, and ΔfrdABCDΔsdhABCD strains has shown that cathodic-derived electrons pass solely through FrdABCD and SdhABCD upon fumarate addition .

  • Complementation experiments: Restoring frdD expression in knockout strains to confirm its role in electron transfer.

  • How does the expression of frdD change under different pathophysiological conditions in uropathogenic E. coli O6:K15:H31?

The expression of frdD in uropathogenic E. coli O6:K15:H31 (strain 536) varies significantly under different pathophysiological conditions:

Oxygen availability:

  • Under anaerobic conditions (such as those found in certain urinary tract infections), frdABCD expression increases approximately 10-fold compared to aerobic conditions .

  • This anaerobic induction is mediated by the FNR protein, which acts as a transcriptional activator .

Electron acceptor availability:

  • Fumarate presence increases frdABCD expression by an additional 1.5-fold .

  • Nitrate, a preferred electron acceptor, decreases expression by about 23-fold .

  • This regulation ensures energy efficiency by prioritizing the use of higher-energy-yielding electron acceptors.

Virulence context:

Methodologies for studying expression changes:

  • qRT-PCR: For measuring transcript levels of frdD under different conditions.

  • Western blotting: To quantify protein levels using antibodies against frdD.

  • Reporter gene fusions: Similar to the frdA'-'lacZ fusions used to study promoter activity under different growth conditions .

  • RNA-seq: For genome-wide transcriptional profiling to place frdD expression in broader context.

  • Proteomics: To study protein abundance changes at a global level.

  • What are the current challenges and solutions in purifying functional recombinant frdD for structural studies?

Purifying functional recombinant frdD presents several challenges due to its hydrophobic nature and integration within a multi-subunit complex:

Current challenges:

  • Membrane protein solubilization: As a hydrophobic membrane protein, frdD is difficult to extract from membranes while maintaining its native structure.

  • Maintaining complex integrity: frdD functions as part of the FrdABCD complex, and isolating it may disrupt important structural features.

  • Inclusion body formation: Overexpression often leads to inclusion body formation, especially at higher inducer concentrations and temperatures .

  • Proper folding: Ensuring correct folding of membrane proteins in recombinant systems is difficult.

Methodological solutions:

  • Co-expression strategies: Express all four subunits (FrdABCD) simultaneously to promote proper complex assembly.

  • Detergent screening: Systematic testing of different detergents for optimal solubilization:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM)

    • Lipid-like detergents such as LMNG

    • Detergent mixtures or amphipols for stabilization

  • Expression optimization:

    • Lower growth temperature (25-30°C)

    • Reduced inducer concentration (e.g., 0.015% arabinose instead of 0.2%)

    • Use of specialized expression hosts like C43(DE3), which are better suited for membrane protein expression

  • Purification approaches:

    • Affinity tags: His-tags or other fusion tags for initial capture

    • Size-exclusion chromatography: To separate properly assembled complexes from aggregates

    • Ligand-based approaches: Using immobilized quinone analogs to select for functional protein

  • Quality assessment:

    • Fluorescence quench titrations with HOQNO to verify quinone binding function

    • EPR spectroscopy to confirm electron transfer capability

    • Activity assays measuring fumarate reduction with appropriate electron donors

  • How do the biochemical properties of E. coli O6:K15:H31 fumarate reductase compare with those from other bacterial species?

The biochemical properties of E. coli O6:K15:H31 fumarate reductase differ significantly from those in other bacterial species, with important implications for research:

Structural organization comparison:

FeatureE. coli O6:K15:H31B. thetaiotaomicronOther Species
Subunit Composition4 subunits (FrdABCD)4 subunits (FrdABCD)3-4 subunits depending on species
Membrane Anchoring2 anchor subunits (FrdC, FrdD)2 anchor subunitsSome species use 1 anchor subunit
CofactorsCovalent FAD, iron-sulfur clustersCovalent FAD, iron-sulfur clustersSome species use non-covalent FAD

Functional differences:

  • Oxygen reactivity: Unlike E. coli fumarate reductase, which can produce reactive oxygen species (ROS) when exposed to oxygen, B. thetaiotaomicron fumarate reductase does not react with oxygen at all - neither superoxide nor hydrogen peroxide is formed .

  • Electron donors: While E. coli fumarate reductase primarily uses menaquinol as an electron donor, other bacterial species may use different electron sources:

    • NADH-dependent fumarate reductases in some species

    • Coenzyme M and coenzyme B in methanogens

  • Kinetic properties: The Km values for fumarate and electron donors vary significantly between species, requiring different assay conditions.

Methodological implications:

  • Expression systems: Different bacterial FRDs may require species-specific expression optimizations:

    • Codon optimization

    • Different chaperone co-expression

    • Variable temperature and inducer conditions

  • Protein purification: The purification protocol used for E. coli FrdABCD (involving butyl-Toyopearl, DEAE-Toyopearl, hydroxyapatite, MonoQ, and Phenyl Superose chromatography steps) may require modification for other species' enzymes .

  • Activity assays: Different spectrophotometric methods may be needed depending on the preferred electron donor:

    • NADH oxidation (340 nm) for NADH-dependent FRDs

    • Succinate production (measured by HPLC) for other types

  • ROS production assessment: When working with FRDs from different species, researchers should evaluate oxygen sensitivity and ROS production, as these properties can vary dramatically and affect experimental design .

Frequently Asked Questions: Recombinant Escherichia coli O6:K15:H31 Fumarate Reductase Subunit D (frdD)

Basic Research Questions

  • What is the structural and functional role of Fumarate reductase subunit D (frdD) in E. coli O6:K15:H31?

Fumarate reductase subunit D (frdD) is a critical component of the membrane-bound fumarate reductase complex in E. coli O6:K15:H31 (strain 536), which functions in anaerobic respiration. This 13 kDa hydrophobic protein contains 119 amino acids and serves as one of the membrane anchor subunits of the FrdABCD complex. The FrdABCD complex catalyzes the reduction of fumarate to succinate, allowing E. coli to utilize fumarate as a terminal electron acceptor during anaerobic growth when oxygen and nitrate are unavailable .

Structurally, frdD works alongside frdC as an anchor subunit, attaching the catalytic subunit (FrdA) and the iron-sulfur subunit (FrdB) to the cell membrane. The membrane-anchoring function is critical for positioning the enzyme within the cell's respiratory chain. FrdC and FrdD accept electrons from quinols (specifically menaquinol in E. coli) and transfer them to FrdB, which then transfers them to FrdA, where fumarate is reduced to succinate .

  • How is the expression of the frdABCD operon regulated in E. coli O6:K15:H31?

The expression of the frdABCD operon in E. coli O6:K15:H31 is tightly regulated at the transcriptional level in response to environmental conditions, particularly the availability of terminal electron acceptors:

  • Oxygen regulation: Expression increases approximately 10-fold during anaerobic growth compared to aerobic conditions .

  • Fumarate induction: The presence of fumarate, the substrate, increases expression by an additional 1.5-fold .

  • Nitrate repression: Nitrate, a preferred electron acceptor, decreases expression by about 23-fold .

This regulation involves several molecular mechanisms:

  • FNR protein: The FNR (fumarate and nitrate reduction) regulatory protein is primarily responsible for anaerobic activation of frd operon expression. In fnr mutants, anaerobic induction is impaired and can be restored when the fnr+ gene is provided in trans .

  • Transcriptional control: The frd mRNA transcript initiates with an adenine residue 93 bases prior to the start of frdA translation and terminates in a uridine-rich region centered at 46 bases after the last codon of frdD .

  • Termination structure: A stem and loop structure serves the dual role of an frd terminator under anaerobic conditions and an ampC attenuator under aerobic conditions .

  • What are the biochemical characteristics of fumarate reductase activity in E. coli?

Fumarate reductase in E. coli exhibits specific biochemical properties that are important for researchers to consider:

  • Reaction catalyzed: FRD reduces fumarate to succinate using two electrons, typically supplied by quinol, FADH2/FMNH2, or NADH .

  • Enzyme kinetics: Standard assay conditions for measuring FRD activity include:

    • Buffer: 50 mM NaPO4 (pH 6.5)

    • Substrate: 20 mM fumarate

    • Electron donor: 0.2 mM NADH

    • Temperature: Often performed at 70°C under anaerobic (Ar gas) conditions

    • Measurement: Decrease in NADH monitored at 340 nm

  • Km values: For accurate kinetic analysis, researchers typically test:

    • Fumarate concentrations: 0.01 to 20 mM

    • NADH concentrations: 0.03 to 0.2 mM

  • Alternative electron donors: The enzyme can also accept electrons from:

    • FADH2 (0.25 mM FAD reduced with dithionite)

    • FMNH2 (0.25 mM FMN reduced with dithionite)

    • Reduced methyl viologen (5 mM MV)

    • Reduced benzyl viologen (10 mM BV)

  • How does the FrdD subunit contribute to quinone binding in the fumarate reductase complex?

The FrdD subunit plays a crucial role in defining the proximal menaquinol (MQH2) binding site (QP) of E. coli fumarate reductase. Based on fluorescence quench (FQ) titrations and site-directed mutagenesis studies:

  • FrdD contributes to forming the quinone binding pocket along with FrdB and FrdC .

  • The H80 residue in FrdD is particularly important for quinone binding; the FrdD-H80K mutation significantly increases the apparent Kd value for HOQNO (a menaquinol analog) from 2.5 nm to 20 nm .

  • The QP site is the sole high-affinity quinone binding site in the FrdABCD complex, as evidenced by monophasic binding in fluorescence quench titrations .

  • Mutations affecting HOQNO binding generally correlate with effects on the observed Km and kcat values for fumarate-dependent quinol oxidation, highlighting the functional importance of proper quinone binding for enzyme activity .

Advanced Research Questions

  • What methodologies are effective for heterologous expression of recombinant E. coli O6:K15:H31 frdD?

For effective heterologous expression of recombinant E. coli O6:K15:H31 frdD, several methodological considerations are critical:

Expression system optimization:

  • Promoter selection: T7 expression systems with arabinose-inducible promoters (PBAD) show lower insoluble protein fractions compared to trc or tac promoters, which is crucial for membrane proteins like frdD .

  • Induction conditions: Using lower inducer concentrations (0.015% arabinose instead of 0.2%) with glucose as carbon source provides finer control over expression levels, helping prevent protein aggregation .

  • Carbon source: Glycerol as a carbon source typically yields higher protein expression levels compared to glucose, but glucose can help "dampen" expression when precise control is needed .

Monitoring and validation approaches:

  • Flow cytometry (FCM): Can be used to rapidly assess protein expression by fusing GFP to frdD. This method correlates well with soluble protein content determined by SDS-PAGE but is much faster (5-10 minutes versus hours) .

  • Solubility assessment: Determine soluble/insoluble fractions through SDS-PAGE and densitometric analysis. For membrane proteins like frdD, detergent screening is essential for extraction and maintaining native conformation .

  • Fluorescence quench titrations: Can be used to confirm proper folding and function of frdD by assessing binding of quinone analogs like HOQNO .

Temperature and expression kinetics:

  • Growth at lower temperatures (typically 25-30°C versus 37°C) allows slower protein production, improving membrane insertion and proper folding of hydrophobic proteins like frdD .

  • Extended induction times at lower temperatures may yield better results than short, high-intensity expression.

  • How can site-directed mutagenesis be applied to study the functional domains of frdD in fumarate reductase activity?

Site-directed mutagenesis is a powerful approach for understanding the structure-function relationship of frdD in the fumarate reductase complex:

Key residues for mutation studies:

  • FrdD-H80: Mutation to lysine (FrdD-H80K) significantly impacts quinone binding, as shown by increasing the apparent Kd for HOQNO from 2.5 nm to 20 nm. This residue is critical for proper interaction with the quinone substrate .

  • Transmembrane helices: The hydrophobic regions that anchor the protein in the membrane can be systematically mutated to determine their role in membrane insertion and complex assembly.

  • Interface residues: Amino acids at the interface with other subunits (particularly FrdC) can be mutated to study subunit interactions.

Methodological approach:

  • Primer design: Design overlapping primers containing the desired mutation following standard protocols for site-directed mutagenesis.

  • PCR amplification: Use high-fidelity polymerase to minimize unwanted mutations.

  • DpnI digestion: To remove methylated template DNA.

  • Transformation: Into competent E. coli cells.

  • Sequence verification: Confirm successful mutagenesis.

Functional analyses of mutants:

  • Fluorescence quench titrations: To measure quinone binding affinity (Kd) of the mutant protein .

  • EPR spectroscopy: To detect bound menasemiquinone radicals and assess electron transfer capability .

  • Steady-state kinetics: Measure fumarate-dependent quinol oxidation to determine Km and kcat values of the mutant proteins .

  • Membrane potential measurements: To assess the impact of mutations on proton translocation.

  • What approaches can be used to investigate the role of frdD in electron transfer within the fumarate reductase complex?

Investigating the role of frdD in electron transfer requires sophisticated biophysical and biochemical approaches:

Spectroscopic techniques:

  • EPR spectroscopy: Essential for detecting and characterizing paramagnetic species such as menasemiquinone radicals formed during electron transfer. EPR can detect when electrons are trapped at specific sites in the electron transport chain, such as the case with the FrdC-E29L mutant where only one electron is removed from menaquinol, resulting in a trapped menasemiquinone radical anion .

  • Fluorescence spectroscopy: Using fluorescence quench titrations with quinone analogs like HOQNO to measure binding affinity and assess the integrity of the quinone binding site .

Electrochemical approaches:

  • Bioelectrochemical reactors: Systems where electrons can be delivered directly to cells from a cathode. These have shown that the Mtr pathway can deliver cathodic electrons via native fumarate reductases to fumarate, with FrdABCD being responsible for approximately 60% of the current consumption .

  • Cyclic voltammetry: To determine the redox potential of the fumarate reductase complex and its components. The catalytic wave for fumarate reduction starts at approximately -43 mV vs. Ag/AgCl, close to the redox potential of FrdAB .

Genetic manipulation:

  • Knockout studies: Comparing current consumption by wild-type, ΔfrdABCD, and ΔfrdABCDΔsdhABCD strains has shown that cathodic-derived electrons pass solely through FrdABCD and SdhABCD upon fumarate addition .

  • Complementation experiments: Restoring frdD expression in knockout strains to confirm its role in electron transfer.

  • How does the expression of frdD change under different pathophysiological conditions in uropathogenic E. coli O6:K15:H31?

The expression of frdD in uropathogenic E. coli O6:K15:H31 (strain 536) varies significantly under different pathophysiological conditions:

Oxygen availability:

  • Under anaerobic conditions (such as those found in certain urinary tract infections), frdABCD expression increases approximately 10-fold compared to aerobic conditions .

  • This anaerobic induction is mediated by the FNR protein, which acts as a transcriptional activator .

Electron acceptor availability:

  • Fumarate presence increases frdABCD expression by an additional 1.5-fold .

  • Nitrate, a preferred electron acceptor, decreases expression by about 23-fold .

  • This regulation ensures energy efficiency by prioritizing the use of higher-energy-yielding electron acceptors.

Virulence context:

Methodologies for studying expression changes:

  • qRT-PCR: For measuring transcript levels of frdD under different conditions.

  • Western blotting: To quantify protein levels using antibodies against frdD.

  • Reporter gene fusions: Similar to the frdA'-'lacZ fusions used to study promoter activity under different growth conditions .

  • RNA-seq: For genome-wide transcriptional profiling to place frdD expression in broader context.

  • Proteomics: To study protein abundance changes at a global level.

  • What are the current challenges and solutions in purifying functional recombinant frdD for structural studies?

Purifying functional recombinant frdD presents several challenges due to its hydrophobic nature and integration within a multi-subunit complex:

Current challenges:

  • Membrane protein solubilization: As a hydrophobic membrane protein, frdD is difficult to extract from membranes while maintaining its native structure.

  • Maintaining complex integrity: frdD functions as part of the FrdABCD complex, and isolating it may disrupt important structural features.

  • Inclusion body formation: Overexpression often leads to inclusion body formation, especially at higher inducer concentrations and temperatures .

  • Proper folding: Ensuring correct folding of membrane proteins in recombinant systems is difficult.

Methodological solutions:

  • Co-expression strategies: Express all four subunits (FrdABCD) simultaneously to promote proper complex assembly.

  • Detergent screening: Systematic testing of different detergents for optimal solubilization:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM)

    • Lipid-like detergents such as LMNG

    • Detergent mixtures or amphipols for stabilization

  • Expression optimization:

    • Lower growth temperature (25-30°C)

    • Reduced inducer concentration (e.g., 0.015% arabinose instead of 0.2%)

    • Use of specialized expression hosts like C43(DE3), which are better suited for membrane protein expression

  • Purification approaches:

    • Affinity tags: His-tags or other fusion tags for initial capture

    • Size-exclusion chromatography: To separate properly assembled complexes from aggregates

    • Ligand-based approaches: Using immobilized quinone analogs to select for functional protein

  • Quality assessment:

    • Fluorescence quench titrations with HOQNO to verify quinone binding function

    • EPR spectroscopy to confirm electron transfer capability

    • Activity assays measuring fumarate reduction with appropriate electron donors

  • How do the biochemical properties of E. coli O6:K15:H31 fumarate reductase compare with those from other bacterial species?

The biochemical properties of E. coli O6:K15:H31 fumarate reductase differ significantly from those in other bacterial species, with important implications for research:

Structural organization comparison:

FeatureE. coli O6:K15:H31B. thetaiotaomicronOther Species
Subunit Composition4 subunits (FrdABCD)4 subunits (FrdABCD)3-4 subunits depending on species
Membrane Anchoring2 anchor subunits (FrdC, FrdD)2 anchor subunitsSome species use 1 anchor subunit
CofactorsCovalent FAD, iron-sulfur clustersCovalent FAD, iron-sulfur clustersSome species use non-covalent FAD

Functional differences:

  • Oxygen reactivity: Unlike E. coli fumarate reductase, which can produce reactive oxygen species (ROS) when exposed to oxygen, B. thetaiotaomicron fumarate reductase does not react with oxygen at all - neither superoxide nor hydrogen peroxide is formed .

  • Electron donors: While E. coli fumarate reductase primarily uses menaquinol as an electron donor, other bacterial species may use different electron sources:

    • NADH-dependent fumarate reductases in some species

    • Coenzyme M and coenzyme B in methanogens

  • Kinetic properties: The Km values for fumarate and electron donors vary significantly between species, requiring different assay conditions.

Methodological implications:

  • Expression systems: Different bacterial FRDs may require species-specific expression optimizations:

    • Codon optimization

    • Different chaperone co-expression

    • Variable temperature and inducer conditions

  • Protein purification: The purification protocol used for E. coli FrdABCD (involving butyl-Toyopearl, DEAE-Toyopearl, hydroxyapatite, MonoQ, and Phenyl Superose chromatography steps) may require modification for other species' enzymes .

  • Activity assays: Different spectrophotometric methods may be needed depending on the preferred electron donor:

    • NADH oxidation (340 nm) for NADH-dependent FRDs

    • Succinate production (measured by HPLC) for other types

  • ROS production assessment: When working with FRDs from different species, researchers should evaluate oxygen sensitivity and ROS production, as these properties can vary dramatically and affect experimental design .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.