Recombinant Escherichia coli O6:K15:H31 Inner membrane protein CbrB (cbrB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Expression System

  • Host: Escherichia coli .

  • Tags: Variable affinity tags (e.g., His-tag) are added during production to facilitate purification .

  • Strains: Engineered E. coli strains (e.g., BL21(DE3)) optimized for disulfide bond formation may be used, though specific details are proprietary .

Association with Virulence

  • UPEC strain 536 is a human pathogen linked to urinary tract infections (UTIs) and pyelonephritis .

  • While cbrB itself is not directly characterized in virulence studies, it resides within a pathogenicity island (PAI V536) that includes genes for the K15 capsule, fimbriae, and secretion systems critical for host colonization and immune evasion .

Functional Inferences

  • Membrane integrity: Predicted to contribute to inner membrane stability or transport processes due to its transmembrane domains .

  • Interaction networks: Potential involvement in protein-protein interactions within membrane complexes, though specific partners remain uncharacterized .

Research Applications

Experimental Use Cases

  • Antigenic studies: Used to probe immune responses in UPEC infections.

  • Structural biology: NMR or crystallography studies to resolve membrane protein architecture (limited data available) .

Key Challenges and Future Directions

Knowledge Gaps

  • Functional annotation: The precise biochemical role of CbrB remains undefined .

  • Structural resolution: No high-resolution 3D structure is publicly available.

Research Opportunities

  • Linking cbrB to UPEC virulence pathways using knockout models.

  • Exploring its utility as a diagnostic marker or vaccine target .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: Our standard shipping includes blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbrB; ECP_3916; Inner membrane protein CbrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
cbrB
Target Protein Sequence
MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLILLVIIQVLPLFLLMSITTGAIP AMLTGVMVACLPEKIGSQKRYRCLVGGIGGVVITEIYCAVIVHIKDMASSALFENILSGE NLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS
Uniprot No.

Target Background

Database Links

KEGG: ecp:ECP_3916

Protein Families
CbrB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CbrB protein in E. coli O6:K15:H31 and what is its function?

CbrB is an inner membrane protein found in E. coli O6:K15:H31 (strain 536/UPEC) that is predicted to contribute to inner membrane stability or transport processes due to its transmembrane domains. The protein is encoded by the cbrB gene (locus tag ECP_3916) and while its precise biochemical role remains undefined, it resides within a pathogenicity island (PAI V536) that includes genes for the K15 capsule, fimbriae, and secretion systems critical for host colonization and immune evasion.

Unlike its well-characterized homolog in Pseudomonas species, the specific function of CbrB in E. coli has not been fully elucidated. In Pseudomonas, CbrB functions as a response regulator in the CbrAB two-component system that controls carbon catabolite repression and regulates the expression of multiple genes involved in carbon source utilization . Whether E. coli CbrB serves similar regulatory functions requires further investigation.

How does recombinant CbrB protein differ from native CbrB?

Recombinant CbrB protein typically includes affinity tags (such as His-tags) that are added during production to facilitate purification. These tags can affect protein folding, activity, or interaction with other proteins compared to the native form. The recombinant protein is usually expressed in engineered E. coli expression systems optimized for protein production, which may result in different post-translational modifications or folding patterns compared to the protein expressed in its native context.

When using recombinant CbrB for experimental purposes, researchers should consider whether the presence of tags might interfere with the specific aspect of protein function being studied. For critical functional assays, tag removal through protease cleavage sites or expression of tag-free versions may be necessary to ensure results reflect native protein behavior.

What are the optimal conditions for expressing recombinant E. coli CbrB protein?

For successful expression of recombinant E. coli CbrB protein, the following methodology is recommended:

  • Expression system selection: Engineered E. coli strains such as BL21(DE3) that are optimized for recombinant protein expression, particularly for membrane proteins, should be utilized. These strains are often modified to enhance disulfide bond formation which can be critical for proper membrane protein folding.

  • Vector design: Expression vectors should include:

    • An inducible promoter (such as T7) for controlled expression

    • Appropriate affinity tags for purification

    • Optimized signal sequences if necessary for membrane targeting

  • Culture conditions:

    • Initial growth at 37°C until mid-log phase

    • Induction at lower temperatures (16-25°C) to slow expression and allow proper folding

    • Longer induction times (overnight) at lower inducer concentrations

  • Host cell considerations: Monitor host cell stress responses, as successful overproduction of membrane proteins is linked to the avoidance of stress responses in the host cell . Quantifying cell response to membrane protein production can help optimize expression conditions.

The balance between protein expression levels and proper membrane insertion is critical, as overexpression can lead to protein aggregation, improper folding, or host cell toxicity.

How can the membrane orientation of recombinant CbrB be determined experimentally?

To determine the membrane orientation of recombinant CbrB, the following reporter fusion techniques have proven effective:

  • BlaM (β-lactamase) fusion method:

    • Fuse BlaM to the C-terminus of CbrB or truncated versions

    • If BlaM is located in the periplasm, cells will show ampicillin resistance

    • If BlaM is in the cytoplasm, cells will be ampicillin sensitive

    • This approach allows determination of C-terminal orientation relative to the membrane

  • EGFP (Enhanced Green Fluorescent Protein) fusion method:

    • Fuse EGFP to the C-terminus of CbrB

    • EGFP fluorescence will be detected when localized to the cytoplasm

    • Fluorescence is inhibited if EGFP is translocated to the periplasm where it is improperly folded and degraded

    • This provides complementary evidence to the BlaM approach

  • Systematic truncation analysis:

    • Create variants containing one, two, or three predicted transmembrane helices

    • Fuse reporter proteins to each variant

    • A periodic relationship between construct length and reporter activity indicates the number and orientation of membrane-spanning segments

These experimental approaches can definitively establish the topology of CbrB in the membrane, which is essential for understanding its function and interactions.

What purification strategies are recommended for obtaining high-quality CbrB protein?

The purification of membrane proteins like CbrB requires specialized approaches:

  • Membrane extraction:

    • Harvest cells and disrupt by sonication or French press

    • Separate membranes by ultracentrifugation

    • Extract membrane proteins using mild detergents (DDM, LDAO, or OG)

  • Affinity chromatography:

    • Utilize the affinity tags (commonly His-tag) present on the recombinant protein

    • Perform binding in the presence of detergent to maintain protein solubility

    • Include imidazole gradient elution to reduce non-specific binding

  • Size exclusion chromatography:

    • Further purify the protein based on size

    • Assess protein aggregation state

    • Confirm proper oligomerization if applicable

  • Storage considerations:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • For extended storage, conserve at -20°C or -80°C

    • Avoid repeated freezing and thawing

    • Working aliquots can be maintained at 4°C for up to one week

Successful purification should be validated through SDS-PAGE, Western blotting, and where possible, functional assays to confirm the protein maintains its native conformation and activity.

How does CbrB function differ between E. coli and Pseudomonas species?

While sharing sequence homology, CbrB proteins demonstrate important functional differences between bacterial species:

CharacteristicE. coli CbrBPseudomonas CbrB
System compositionNot fully characterizedPart of CbrAB two-component system
Regulatory rolePutative membrane functionGlobal regulator affecting 61+ genes
Transcriptional activityUnknownσN-dependent activator
Metabolic controlNot characterizedControls carbon catabolite repression
sRNA interactionUnknownRegulates crcZ and crcY sRNAs
Phosphorylation dependencyUnknownBarely dependent on phosphorylation

In Pseudomonas, the CbrAB system responds to carbon limiting conditions and directly controls the expression of at least 61 genes . These include regulatory functions (20%), porines/transporters (20%), metabolic enzymes (16%), activities related to protein translation (5%), and uncharacterized functions (38%) .

Unlike typical response regulators, Pseudomonas CbrB is unusual in that it is barely dependent on phosphorylation for transcriptional activation . Whether E. coli CbrB shares this characteristic requires further investigation, as its regulatory functions remain largely undefined.

What techniques can be used to study CbrB-DNA interactions and identify its binding sites?

For researchers investigating potential regulatory functions of CbrB in E. coli, the following techniques have been successfully applied to study Pseudomonas CbrB and could be adapted:

  • Chromatin Immunoprecipitation (ChIP) analysis:

    • Perform in vivo binding analysis to identify direct regulatory targets

    • This approach identified 61 genes directly controlled by CbrB in P. putida

  • DNA binding site characterization:

    • Analyze binding sequences of identified targets

    • In Pseudomonas, CbrB binding involves three independent non-palindromic subsites with variable spacing

  • Multimerization analysis:

    • Determine the oligomerization state of CbrB when bound to DNA

    • Assess dependence on other factors such as RpoN or IHF

  • Promoter dissection:

    • Create reporter constructs with systematic mutations in putative binding sites

    • Test activation by CbrB to define minimal requirements for binding

If E. coli CbrB functions as a transcriptional regulator like its Pseudomonas homolog, these approaches would help identify its regulon and mechanism of action. This would be particularly valuable for understanding its potential role in pathogenicity, given its location within a pathogenicity island in uropathogenic E. coli.

How does CbrB contribute to the pathogenicity of uropathogenic E. coli?

The contribution of CbrB to UPEC pathogenicity represents an important research direction:

  • Pathogenicity island context:

    • CbrB resides within pathogenicity island PAI V536 that includes genes for the K15 capsule, fimbriae, and secretion systems

    • Its co-localization with known virulence factors suggests potential involvement in pathogenicity

  • Potential mechanisms:

    • Membrane integrity maintenance during host colonization

    • Possible involvement in nutrient acquisition during infection

    • Potential role in stress response to host defense mechanisms

  • Experimental approaches to investigate pathogenicity:

    • Generation of cbrB deletion mutants in UPEC background

    • Virulence assessment using cell culture and animal models

    • Transcriptome analysis comparing wild-type and mutant strains under infection-relevant conditions

    • Protein interaction studies to identify partners in virulence-associated processes

While direct evidence for CbrB's role in virulence is currently limited, its genomic context in a pathogenicity island suggests potential contributions to uropathogenic E. coli virulence that warrant further investigation.

Why might recombinant CbrB expression levels be low, and how can this be improved?

Low expression of membrane proteins like CbrB is a common challenge with several potential causes and solutions:

  • Toxicity to host cells:

    • Problem: Membrane protein overexpression can disrupt host cell membrane integrity

    • Solution: Use tightly regulated inducible systems and lower induction temperatures (16-20°C)

  • Codon usage bias:

    • Problem: Rare codons in the cbrB sequence may limit translation efficiency

    • Solution: Use codon-optimized synthetic genes or expression in strains with rare tRNA supplementation

  • Protein misfolding and aggregation:

    • Problem: Improper folding leading to inclusion body formation

    • Solution: Co-express with chaperones or foldases; add stabilizing agents like glycerol or specific detergents

  • Host cell stress responses:

    • Problem: Expression triggering stress responses that limit yield

    • Solution: Monitor and mitigate cellular stress responses; consider specialized expression strains

  • Experimental verification:

    • Quantify expression at transcript level (RT-qPCR) and protein level (Western blotting)

    • Distinguish between expression issues and extraction/purification difficulties

    • Assess membrane insertion efficiency using reporter fusions as described previously

Understanding that successful overproduction of some membrane proteins is linked to the avoidance of stress responses in the host cell can guide optimization strategies .

How can researchers distinguish between functional and non-functional forms of recombinant CbrB?

Verifying the functionality of recombinant CbrB requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Size-exclusion chromatography to confirm proper oligomerization state

    • Limited proteolysis to assess proper folding

  • Membrane integration analysis:

    • Fluorescence-based assays to confirm proper membrane insertion

    • Protease protection assays to verify predicted topology

    • Reporter fusion assays as described in section 2.2

  • Functional complementation:

    • Express recombinant CbrB in cbrB deletion mutants

    • Assess restoration of phenotypes (if known)

    • In Pseudomonas, growth on phenylalanine as a sole carbon source depends on cbrB function and could serve as a functional assay

  • Binding assays (if regulatory function is established):

    • Electrophoretic mobility shift assays (EMSA) to test DNA binding

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Fluorescence anisotropy to assess protein-ligand interactions

Without established functional assays specific to E. coli CbrB, researchers may need to develop new assays based on phenotypic changes observed in deletion mutants or inferred from homology to better-characterized systems like Pseudomonas CbrB.

What comparative genomics approaches can reveal insights about CbrB function across bacterial species?

Comparative genomics offers powerful tools for understanding CbrB function:

  • Phylogenetic analysis:

    • Compare CbrB sequences across diverse bacterial species

    • Identify conserved domains and species-specific adaptations

    • Correlate sequence variations with ecological niches and metabolic capabilities

  • Genomic context analysis:

    • Examine conservation of neighboring genes across species

    • Identify co-evolution patterns that suggest functional relationships

    • Compare pathogenicity island organization between different UPEC strains

  • Regulatory network reconstruction:

    • Compare known CbrB regulons in different species (e.g., the 61 genes identified in Pseudomonas)

    • Predict potential targets in E. coli based on sequence similarities

    • Identify conserved binding motifs in promoter regions

  • Experimental validation strategies:

    • Cross-species complementation studies

    • Hybrid protein construction and functional testing

    • Binding site swapping experiments

This approach could help determine whether E. coli CbrB functions similarly to its Pseudomonas homolog in regulating carbon metabolism or whether it has evolved species-specific functions related to uropathogenicity.

How might CbrB interact with other two-component systems in bacterial regulatory networks?

The potential integration of CbrB with other regulatory systems represents an important research area:

  • Network mapping approaches:

    • Transcriptome analysis of cbrB mutants under various conditions

    • Proteomic analysis to identify protein-protein interactions

    • Phosphorylation state analysis to identify cross-talk with other two-component systems

  • Potential interactions based on Pseudomonas studies:

    • In Pseudomonas, CbrB controls expression of the small RNAs crcZ and crcY

    • These sRNAs sequester Crc, affecting carbon catabolite repression

    • Similar regulatory cascades may exist in E. coli

  • Signal integration hypothesis:

    • CbrB may serve as an integration point for multiple environmental signals

    • Its position in a pathogenicity island suggests potential coordination with virulence regulation

    • The relationship between carbon metabolism and virulence expression is an important research direction

  • Experimental design considerations:

    • Create reporter constructs for key genes in multiple pathways

    • Perform epistasis analysis with multiple regulatory system mutations

    • Use quantitative models to understand regulatory dynamics

Understanding these interactions could reveal how bacterial pathogens coordinate metabolic adaptation with virulence gene expression during infection processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.