Recombinant Escherichia coli O6:K15:H31 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Biological Role of MscL

MscL's primary function is to protect bacteria from osmotic shock, which occurs when there is a sudden change from a high osmolarity environment to a low osmolarity environment . This transition causes water to rush into the cell, increasing turgor pressure and potentially leading to cell lysis . MscL releases cytoplasmic solutes to reduce turgor pressure, preventing the cell from bursting . MscL has been found in bacteria, archaea, fungi, and plants, highlighting its evolutionary importance .

Structure and Function

MscL opens a nonselective pore when the membrane is stretched, allowing water, ions, metabolites, and even small proteins to pass through . The open pore can dilate to approximately 30 Å wide, exhibiting a large unitary conductance of roughly 3 nS . MscL's large conformational change is responsible for its unitary conductance and lack of selectivity, allowing particles with a molecular weight smaller than approximately 1,000 to pass through .

Gating Mechanism

MscL's gating mechanism involves significant conformational changes as it transitions from a closed to an open state . The pore expands to ~30Å in diameter when closed, with a change of 15-16Å upon opening . The membrane-mediated mechanism, which relies on changes in membrane thickness or curvature, moderates the gating of MscL . When the membrane is stretched, MscL experiences a pull concentrated in the interfacial regions, leading to an iris-like expansion and flattening of the MscL barrel .

Conformational Changes in the Periplasmic Loop Region

The periplasmic loop of MscL influences its gating kinetics and mechanosensitivity . The loop contains an "ω"-shaped structure (ω-loop) and a short β-hairpin structure that fold the polypeptide chain at the resting closed state . These structures also allow the loop to stretch when the channel opens in response to mechanical force . Interactions between the loop and the C-terminal end of TM1 stabilize the channel at the resting closed state .

MscL as a Model System

MscL is a model system for studying mechanosensation through various approaches, including electrophysiology, biochemistry, genetics, structural biology, and molecular dynamic simulation . Studies on MscL have provided insights into the physical principle of the mechanical coupling mechanism, which coordinates the multiple structural elements of this nanoscale valve .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
mscL; ECP_3378; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LREAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAATPAPTKEE VLLTEIRDLLKEQNNRS
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.

Database Links

KEGG: ecp:ECP_3378

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the MscL channel gating mechanism respond to membrane tension?

The MscL channel functions as a biological pressure valve that responds to membrane tension. When studying the gating mechanism, researchers have identified that:

  • The transition from closed to open states involves significant conformational changes

  • Mechanical force transmitted through the lipid bilayer triggers channel opening

  • The channel responds to stretch forces by undergoing a clockwise rotation of transmembrane domain 1 during early gating

To investigate this mechanism experimentally, researchers have employed techniques such as:

  • Engineering single-site histidine substitutions

  • Assessing the effects of metal ions (Ni²⁺, Cd²⁺, Zn²⁺) on channel activity

  • Electrophysiological measurements using patch-clamp techniques

Studies have shown that certain mutations, such as L19H, exhibit interesting gating properties that are differentially affected by various metal ions. For example, this mutant's gating was inhibited by Cd²⁺ but stimulated by Ni²⁺, suggesting these metals bind to and influence different states of the channel .

What are the recommended methods for expression and purification of recombinant MscL?

The expression and purification of recombinant MscL protein have been accomplished using several approaches:

Expression Systems:

  • Expression as a fusion protein with glutathione S-transferase (GST) in E. coli strains containing a disruption in the chromosomal mscL gene

  • Expression with an N-terminal 6xHis tag in E. coli

Purification Protocol:

  • For GST-fusion proteins:

    • Purify using glutathione-coated beads

    • Employ thrombin cleavage to recover the MscL protein

  • For His-tagged proteins:

    • Use immobilized metal affinity chromatography

    • Elute with imidazole-containing buffers

    • Achieve >85-90% purity as determined by SDS-PAGE

Storage Recommendations:

  • Store at -20°C/-80°C as a lyophilized powder or in solution with 50% glycerol

  • Avoid repeated freeze-thaw cycles

  • For working solutions, store aliquots at 4°C for up to one week

How can I verify the functionality of purified recombinant MscL protein?

Verification of MscL functionality is crucial before using it in experiments. Methods include:

  • Reconstitution into artificial liposomes:

    • Incorporate the purified protein into liposomes

    • Confirm channel function using patch-clamp techniques

    • Verify characteristic conductance and pressure sensitivity

  • Inhibition studies:

    • Test channel blockade with mechanosensitive ion channel inhibitors such as gadolinium

    • Assess inhibition by specific anti-MscL polyclonal antibodies

  • Functional verification markers:

    • Observe characteristic large conductance (~3 nS)

    • Confirm threshold tension for activation

    • Evaluate sensitivity to known modulators

This functional verification is essential, as structural integrity during purification doesn't guarantee functional integrity of the channel protein.

Which key residues have been identified in the MscL pore, and how do they affect channel function?

Studies using site-directed mutagenesis have identified several key residues that line the MscL pore. Research has particularly focused on:

  • Residues in transmembrane domain 1 (TM1):

    • These residues are critical for the channel's gating properties

    • Substitution mutations affect channel threshold pressure

  • Specific mutations with notable effects:

    • L19H mutation: Shows differential responses to metal ions (inhibited by Cd²⁺ but stimulated by Ni²⁺)

    • This suggests different metal binding affects distinct conformational states of the channel

When conducting mutagenesis studies, researchers should consider:

  • The direction and extent of changes in threshold pressure depend on both the specific mutation and the metal ion used

  • Mutations can affect either the closed state or the transition states during channel opening

  • Single-site histidine substitutions can be particularly informative when paired with metal ion studies

How can I design experiments to study the gating mechanism of MscL using mutagenesis?

To investigate MscL gating mechanisms through mutagenesis:

  • Target selection for mutagenesis:

    • Focus on residues predicted to line the pore in either closed or transitional states

    • Consider residues involved in transmembrane helix interactions

    • Select residues at key locations that may participate in conformational changes

  • Experimental approach:

    • Engineer single-site histidine substitutions at targeted positions

    • Express mutant proteins (methods as described in section 2.1)

    • Reconstitute purified proteins into liposomes

    • Assess channel activity using patch-clamp techniques

  • Functional analysis:

    • Measure baseline channel activity

    • Test the effects of metal ions (Ni²⁺, Cd²⁺, Zn²⁺) on channel gating

    • Analyze changes in threshold pressure, conductance, and gating kinetics

    • Compare results with predictions from structural models

This methodological approach has successfully provided evidence supporting hypotheses about conformational changes during MscL gating, including the clockwise rotation of TM1 early in the process .

What role does MscL play in bacterial stress response and osmotic regulation?

MscL functions as a "pressure-release valve" in bacterial membranes:

  • Osmotic pressure regulation:

    • Opens in response to membrane tension during hypoosmotic shock

    • Releases small cytoplasmic solutes to prevent cell lysis

    • Works in concert with other mechanosensitive channels (like MscS) to form a graded emergency response system

  • Stress response:

    • Protects cells from sudden osmotic downshifts

    • May be involved in mechanosensing of other environmental stresses

    • Could potentially interact with other stress response pathways

When studying MscL's physiological role, researchers should consider:

  • The threshold of activation relative to other mechanosensitive channels

  • The selectivity and conductance properties that determine what substances can be released

  • The kinetics of channel opening and closing in response to osmotic changes

How is MscL expression regulated in E. coli strains, and what implications does this have for bacterial adaptation?

The regulation of MscL expression in E. coli is complex and may vary between strains:

  • Genomic context:

    • In E. coli O6:K15:H31 strain 536, MscL is encoded by the gene mscL (ECP_3378)

    • Some strains may show differential regulation based on their ecological niche or pathogenic potential

  • Regulatory factors:

    • Expression may be influenced by osmotic stress conditions

    • Growth phase and metabolic state likely affect expression levels

    • Potential regulation by global stress response regulators

  • Experimental approaches to study regulation:

    • RNA isolation and Northern blot analysis to measure transcript levels under different conditions

    • Reporter gene fusions to monitor promoter activity

    • Western blot analysis with anti-MscL antibodies to assess protein levels

    • Genetic complementation studies to verify gene function

Understanding MscL regulation provides insights into bacterial adaptation strategies during environmental transitions and stress conditions.

How can recombinant MscL be used in competition assays to study bacterial fitness?

Recombinant MscL can be utilized in competition assays to investigate bacterial fitness and adaptation:

  • Methodology for competition experiments:

    • Create strains with defined genetic backgrounds (e.g., wild-type vs. mscL mutants)

    • Use antibiotic resistance markers (e.g., kanamycin) to distinguish strains

    • Co-culture strains in a 1:1 ratio under defined conditions

    • Sample at regular intervals, dilute, and plate on selective media

    • Calculate competitive index based on colony counts

  • Experimental considerations:

    • Verify that addition of resistance markers doesn't alter growth behavior

    • Monitor starting ratios carefully (commonly OD₆₀₀ of 0.05 for each strain)

    • Include appropriate controls with non-competitive growth

    • Consider monitoring competition at multiple timepoints for detailed analysis

Such competition assays have been used successfully to demonstrate the competitive advantage of certain E. coli strains (like asymptomatic bacteriuria strain 83972) over uropathogenic E. coli strains in human urine, both in vitro and in vivo .

What is the relationship between MscL function and bacterial pathogenicity in E. coli O6:K15:H31?

E. coli O6:K15:H31 (strain 536) is a uropathogenic isolate that contains specific virulence factors. The relationship between MscL function and pathogenicity is complex:

  • Pathogenicity islands:

    • Strain 536 carries two large DNA regions (pathogenicity islands PAI I and PAI II)

    • These regions encode virulence factors like hemolysin (hly) and P-related fimbriae (prf)

    • The islands can be spontaneously deleted, affecting virulence

  • Regulatory networks:

    • Global regulators like RfaH affect multiple virulence factors in strain 536

    • RfaH disruption leads to decreased expression of virulence factors like K15 capsule and alpha-hemolysin

    • Complementation of mutants restores wild-type virulence levels

  • Research approaches:

    • Gene disruption with marker cassettes (e.g., chloramphenicol acetyltransferase)

    • Allelic exchange using suicide vectors

    • Complementation with cloned genes

    • Analysis by Western blotting, ELISA, and in vivo models

While direct evidence linking MscL to pathogenicity is limited, understanding its role in osmotic regulation and stress response may provide insights into bacterial survival during infection and host-pathogen interactions.

What are the critical factors in reconstituting functional MscL into artificial liposomes?

Successful reconstitution of MscL into artificial liposomes requires attention to several critical factors:

  • Lipid composition:

    • Consider the lipid bilayer composition that supports MscL function

    • Phosphatidylcholine and phosphatidylethanolamine are commonly used

    • Membrane thickness and fluidity affect channel gating properties

  • Reconstitution protocol:

    • Use detergent-mediated reconstitution followed by detergent removal

    • Control protein-to-lipid ratios carefully

    • Consider sonication or extrusion to create uniformly sized liposomes

    • Remove residual detergent completely to prevent artifacts

  • Functional verification:

    • Confirm incorporation using patch-clamp techniques

    • Verify characteristic conductance (~3 nS)

    • Test pressure sensitivity and response to known modulators

    • Use inhibitors like gadolinium as controls

The reconstituted recombinant MscL has been successfully shown to form ion channels with characteristic conductance and pressure sensitivity identical to native channels, confirming the validity of this approach .

How can I design experiments to investigate MscL interactions with other membrane proteins or cellular components?

To investigate MscL interactions with other cellular components:

  • Co-immunoprecipitation approaches:

    • Generate antibodies against MscL or use tagged versions

    • Solubilize membranes with mild detergents to preserve protein-protein interactions

    • Immunoprecipitate MscL and identify co-precipitating proteins by mass spectrometry

  • Genetic interaction studies:

    • Create double mutants of mscL with genes of interest

    • Assess synthetic phenotypes under osmotic stress conditions

    • Use complementation studies to verify specific interactions

  • Fluorescence-based approaches:

    • Create fluorescently tagged MscL variants

    • Use FRET or BRET to detect protein-protein interactions

    • Employ fluorescence correlation spectroscopy to analyze protein complexes

  • Reconstitution studies:

    • Co-reconstitute MscL with candidate interacting proteins

    • Assess functional consequences using electrophysiological techniques

    • Compare channel properties in the presence and absence of interacting partners

Understanding MscL's protein-protein interactions could provide insights into how mechanosensation is integrated with other cellular processes and stress responses in bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.