Recombinant Escherichia coli O6:K15:H31 NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
nuoA; ECP_2327; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This process couples redox reactions with proton translocation; specifically, four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links

KEGG: ecp:ECP_2327

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase subunit A (nuoA) in E. coli metabolism?

The nuoA protein functions as a membrane subunit of the NADH:ubiquinone oxidoreductase complex (also known as NDH-1 or Complex I), playing a crucial role in the electron transport chain. This complex shuttles electrons from NADH, via FMN and iron-sulfur centers, to ubiquinone in the respiratory chain, coupling the redox reaction to proton translocation across the cytoplasmic membrane. For every two electrons transferred, four hydrogen ions are translocated, generating proton motive force essential for ATP synthesis . nuoA specifically serves as one of the membrane-embedded components potentially involved in maintaining the structural integrity of the complex and facilitating proton translocation.

How does nuoA structurally integrate within the bacterial membrane?

nuoA is a hydrophobic membrane protein characterized by multiple transmembrane domains. Based on available sequence data, it contains several hydrophobic regions consistent with a membrane-spanning topology . The protein integrates into the bacterial inner membrane with specific regions likely involved in interactions with other NDH-1 subunits and potentially participating in the proton translocation pathway. Experimental approaches to studying nuoA's membrane topology include cysteine scanning mutagenesis coupled with accessibility studies, and fluorescence resonance energy transfer (FRET) analysis to determine proximity relationships with other subunits in the complex.

How does the function of nuoA differ from other related subunits like NqrF?

While nuoA is part of the NDH-1 complex, it functions differently from subunits like NqrF found in the Na⁺-translocating NADH:quinone oxidoreductase. NqrF contains FAD and a [2Fe-2S] cluster, harboring the active site for NADH oxidation and acting as a converter between the hydride donor NADH and subsequent one-electron reaction steps . In contrast, nuoA lacks these cofactors and likely plays a structural role in the proton translocation machinery rather than directly participating in electron transfer. This functional distinction underscores the specialized roles of different subunits within respiratory complexes.

What expression systems are most effective for producing recombinant nuoA?

The optimal expression of recombinant nuoA requires specialized approaches due to its membrane-bound nature:

  • Host strain selection: Using E. coli K-12 derivatives specialized for membrane protein expression, such as C41(DE3) or C43(DE3). Strains like BL21(DE3), W3110, or MG1655 listed in K-12 derivative strains may be suitable depending on the experimental goals .

  • Vector design: Incorporation of appropriate fusion tags (His, FLAG, or GFP) and codon optimization for E. coli expression.

  • Vesicle-based expression: Recent innovations in vesicle-packaged recombinant protein production offer promising alternatives. A vesicle nucleating peptide (VNp) system can facilitate the export of membrane-bound proteins like nuoA in extracellular vesicles, creating a microenvironment that maintains protein functionality and allows for easier purification .

  • Induction conditions: Lower temperatures (16-20°C), reduced inducer concentrations, and longer expression times can significantly improve proper folding of membrane proteins.

What purification strategies yield functional nuoA protein?

Purification of recombinant nuoA requires specialized approaches to maintain structural integrity:

  • Membrane isolation: Following cell lysis, differential centrifugation separates the membrane fraction containing nuoA.

  • Detergent screening: Systematic testing of detergents (n-dodecyl-β-D-maltoside, digitonin, CHAPS) for optimal solubilization of nuoA while preserving function.

  • Chromatography sequence:

    • Initial purification via affinity chromatography using fusion tags

    • Ion exchange chromatography for removing contaminants

    • Size exclusion chromatography for final polishing and detergent exchange

  • Vesicle-based purification: If using the vesicle export approach, ultracentrifugation can isolate vesicles containing nuoA, potentially preserving native-like environment and activity .

  • Quality assessment: SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to verify monodispersity and oligomeric state.

What analytical methods can accurately assess nuoA activity in experimental systems?

Assessing nuoA activity presents challenges since it functions as part of the larger NDH-1 complex:

  • Reconstitution assays: Incorporating purified nuoA into proteoliposomes or nanodiscs along with other NDH-1 subunits to reconstitute activity.

  • Proton translocation assays: Using pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor proton movement across membranes in reconstituted systems.

  • Complementation studies: Testing if recombinant nuoA can restore function in nuoA-deficient E. coli strains by measuring growth rates under respiratory conditions.

  • Electron paramagnetic resonance (EPR): To detect changes in the redox state of nearby iron-sulfur clusters when investigating interaction with other subunits.

  • Statistical validation: Implementing analysis of variance (ANOVA) designs to rigorously evaluate experimental conditions affecting nuoA function4.

How do specific amino acid residues in nuoA contribute to proton translocation?

Investigating the structure-function relationship requires sophisticated approaches:

  • Site-directed mutagenesis: Systematic mutation of conserved residues, particularly those containing charged or polar groups that might participate in proton channels.

  • Hydrogen-deuterium exchange mass spectrometry: To identify dynamic regions and solvent-accessible residues during electron transport.

  • Molecular dynamics simulations: To model potential proton pathways through nuoA and adjacent subunits, with particular focus on conserved residues in transmembrane domains.

  • Voltage-clamp electrophysiology: When reconstituted in artificial membranes, to measure proton currents associated with nuoA function.

  • Cross-linking studies: To identify interaction partners and conformational changes during the catalytic cycle.

How does the E. coli nuoA mechanistically interact with other subunits in the NDH-1 complex?

Understanding subunit interactions requires integrated structural and functional approaches:

  • Cross-linking coupled with mass spectrometry: To map interaction interfaces between nuoA and other subunits.

  • Cryo-EM or X-ray crystallography: To determine the structural position of nuoA within the complete NDH-1 complex.

  • FRET analysis: Using fluorescently labeled subunits to measure distances and dynamics between nuoA and other components.

  • Split-protein complementation assays: To verify specific interactions in vivo.

  • Genetic suppressor analysis: Identifying second-site mutations that restore function in nuoA mutants.

What are the evolutionary implications of nuoA conservation across bacterial species?

Evolutionary analysis provides insights into essential functional regions:

  • Comparative genomics: Multiple sequence alignment of nuoA homologs across diverse bacterial species to identify conserved residues.

  • Selection pressure analysis: Calculating dN/dS ratios to identify regions under purifying or positive selection.

  • Ancestral sequence reconstruction: To trace the evolutionary trajectory of nuoA and identify functionally important changes.

  • Horizontal gene transfer analysis: To determine if nuoA has been horizontally transferred between bacterial lineages.

How can researchers address common challenges in nuoA expression and purification?

Membrane proteins like nuoA present specific technical challenges:

ChallengeTroubleshooting Approach
Low expression yield- Optimize codon usage for E. coli
- Test different promoters (T7, tac, araBAD)
- Explore vesicle-based expression systems
Protein aggregation- Lower induction temperature (16-20°C)
- Add stabilizing agents (glycerol, specific lipids)
- Screen different detergents
Host cell toxicity- Use tightly controlled inducible systems
- Employ specialized E. coli strains
- Consider vesicle export systems to remove protein from cells
Improper folding- Co-express with chaperones
- Include specific lipids in growth media
- Optimize detergent:protein ratio during solubilization
Loss of activity during purification- Minimize purification steps
- Maintain consistent temperature
- Include stabilizing ligands or lipids

What statistical approaches should be applied when analyzing nuoA functional data?

Robust statistical analysis is crucial for interpreting nuoA functional data:

How can researchers validate antibodies and detection reagents for nuoA studies?

Rigorous validation ensures reliable detection:

  • Genetic controls: Testing antibodies against wild-type versus nuoA knockout strains.

  • Epitope mapping: Identifying the specific regions recognized by antibodies.

  • Western blot validation: Confirming single band of appropriate molecular weight.

  • Cross-reactivity assessment: Testing against purified related proteins from the NDH-1 complex.

  • Mass spectrometry confirmation: Verifying the identity of immunoprecipitated proteins.

How can nuoA research inform antimicrobial development targeting bacterial respiration?

NDH-1 represents a potential drug target due to its essential role in bacterial energy metabolism:

  • High-throughput screening: Developing assays to identify compounds that specifically inhibit nuoA function or assembly into the NDH-1 complex.

  • Structure-based drug design: Using structural information about nuoA to design molecules that disrupt its function.

  • Synergistic drug interactions: Investigating whether inhibitors of nuoA potentiate the effects of existing antibiotics, particularly against pathogenic E. coli strains.

  • Resistance mechanisms: Studying how mutations in nuoA might confer resistance to respiratory inhibitors.

  • Specificity analysis: Comparing bacterial nuoA to mitochondrial complex I components to identify bacterial-specific targets.

How does nuoA contribute to bacterial adaptation to different environmental conditions?

Understanding nuoA's role in environmental adaptation:

  • Transcriptional regulation: Analyzing how nuoA expression changes under different growth conditions (aerobic vs. anaerobic, nutrient limitation).

  • Post-translational modifications: Identifying how modifications of nuoA might regulate NDH-1 activity in response to environmental changes.

  • Alternative complex assembly: Determining if nuoA participates in alternative respiratory complexes under stress conditions.

  • Competitive fitness assays: Comparing growth of wild-type versus nuoA mutant strains under various environmental stressors.

  • Metabolic flux analysis: Measuring how nuoA mutations affect carbon and energy flux through central metabolism.

What opportunities exist for engineering nuoA to enhance bioenergy applications?

Bioengineering applications of modified nuoA:

  • Directed evolution: Developing nuoA variants with enhanced electron transfer efficiency or altered substrate specificity.

  • Chimeric complex design: Creating hybrid respiratory chains incorporating engineered nuoA to optimize electron transfer for bioenergy applications.

  • Synthetic biology approaches: Integrating engineered nuoA into artificial electron transport systems for biofuel production or bioelectricity generation.

  • Stability engineering: Modifying nuoA to improve thermal or pH stability for industrial applications.

  • Heterologous expression optimization: Developing improved systems for high-yield production of functional nuoA in industrial strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.