Recombinant Escherichia coli O6:K15:H31 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in NDH-1

The NDH-1 complex in E. coli couples NADH oxidation to quinone reduction and proton translocation. Subunit nuoK is part of the membrane domain, contributing to:

  • Proton Translocation: NDH-1 pumps protons across the membrane, generating a proton motive force for ATP synthesis .

  • Electron Transfer: While nuoK itself lacks iron-sulfur clusters, it interacts with subunits containing these clusters (e.g., NuoI, NuoB) to facilitate electron flow from NADH to quinone .

Mutational studies on other subunits (e.g., NuoA) highlight the sensitivity of NDH-1 activity to conserved charged residues, underscoring the complex’s structural and functional interdependence .

Production and Handling

The recombinant nuoK is produced under controlled conditions:

ParameterValueSource
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Storage-20°C/-80°C (long-term); 4°C (short-term working aliquots)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

Repeated freeze-thaw cycles are discouraged to preserve activity.

Biochemical Studies

  • Enzyme Activity Assays: Used to study NDH-1’s electron transfer kinetics and proton-pumping efficiency .

  • Structural Analysis: His-tagged nuoK facilitates crystallization or NMR studies of subunit interactions .

Diagnostic Tools

  • ELISA Development: Recombinant nuoK serves as an antigen in immunoassays to detect anti-E. coli antibodies .

Pathogenicity Context

The O6:K15:H31 strain is a uropathogenic E. coli (UPEC) model, with its K15 capsule encoded by a pathogenicity island (PAI V536) . While nuoK is not a virulence factor, its study aids in understanding bacterial metabolism and potential therapeutic targets.

Electron Transfer Dynamics

EPR studies on NDH-1 subunits (e.g., NuoI) reveal critical residues in electron tunneling. Though nuoK lacks Fe/S clusters, its role in stabilizing the membrane domain is inferred from structural homology .

Mutational Sensitivity

Mutations in conserved residues (e.g., Asp-79, Glu-81 in NuoA) disrupt NDH-1 activity, highlighting the complex’s reliance on charged interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
nuoK; ECP_2318; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: ecp:ECP_2318

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of the nuoK subunit in E. coli Complex I?

The nuoK subunit (bacterial homologue of mitochondrial ND4L) is an integral membrane component of the proton-translocating NADH-quinone oxidoreductase (Complex I) in E. coli. It plays a critical role in the coupling mechanism that links electron transfer to proton translocation across the membrane. The nuoK subunit contains highly conserved acidic residues, particularly glutamic acids that are embedded within the membrane domain, which are essential for the proton pumping function of Complex I. Mutations of these conserved residues result in significant loss of coupled electron transfer activity and diminished generation of electrochemical gradient, indicating their importance in energy transduction . The nuoK subunit thus represents one of the key components in the membrane arm of Complex I that contributes to respiratory chain function and cellular energy production.

How does nuoK compare with its mitochondrial homologue ND4L?

The nuoK subunit in E. coli represents the bacterial homologue of the mitochondrial ND4L subunit, which is the smallest mitochondrial DNA-encoded component of Complex I. Both proteins share conserved structural and functional features despite evolutionary divergence between bacterial and mitochondrial systems. The core conserved elements include key membrane-embedded acidic residues, particularly glutamic acids, which are essential for proton translocation function in both systems. In E. coli, these critical residues have been identified as Glu-36 and Glu-72, with mutations at these positions leading to significant disruption of coupled electron transfer activities . Both nuoK and ND4L are hydrophobic proteins embedded in the membrane domain of their respective complexes. The bacterial model provides advantages for structural and functional studies due to the relative simplicity of E. coli Complex I compared to its mitochondrial counterpart, while maintaining the core mechanistic features of interest to researchers.

What are the key structural characteristics of the nuoK subunit?

The nuoK subunit of E. coli Complex I is characterized by its small size and hydrophobic nature, consistent with its function as a membrane-embedded component. Structural studies using cryo-electron microscopy have provided detailed insights into its conformation and integration within the larger complex. Key structural features include transmembrane helices that anchor the protein within the membrane domain of Complex I. The subunit contains critically important acidic residues, particularly Glu-36 and Glu-72, which are highly conserved and located within the membrane region . These residues are positioned to participate in proton translocation pathways. Additionally, the nuoK subunit contains arginine residues predicted to be located on the cytosolic side of the membrane, which also contribute to coupled electron transfer activities. The protein's structural integrity is essential for proper assembly of Complex I, as demonstrated by blue-native gel electrophoresis and immunostaining analyses showing that point mutations in nuoK allow for complete complex assembly despite functional impairments .

How have cryo-EM techniques enhanced our understanding of nuoK's integration within Complex I?

Cryo-electron microscopy (cryo-EM) has revolutionized structural analysis of Complex I, providing unprecedented resolution of the nuoK subunit's position and interactions within the larger respiratory complex. The single-particle cryo-EM structure of the entire catalytically active E. coli Complex I reconstituted into lipid nanodiscs has revealed nuoK's integration within the membrane domain at resolutions permitting visualization of individual atoms in iron-sulfur clusters and side chain conformations . This high-resolution structural data allows researchers to precisely map the relationship between nuoK and adjacent subunits, particularly its interactions with other membrane domain components. The technical advancement of resolving hydrating waters in the primary and secondary interaction spheres has been particularly valuable for understanding potential proton pathways involving nuoK's conserved acidic residues. Cryo-EM has further revealed conformational dynamics between Complex I subunits that were previously undetectable, including rotation of subunits relative to one another, which may have functional implications for the coupling mechanism in which nuoK participates . These structural insights have provided a foundation for rational design of mutagenesis studies targeting specific residues based on their precise spatial arrangement.

How do the unique structural features of E. coli Complex I peripheral arm influence interactions with the membrane domain containing nuoK?

The E. coli Complex I peripheral arm exhibits distinctive structural features that stabilize its assembly and potentially influence its interactions with the membrane domain containing nuoK. Unlike other structurally characterized homologues, E. coli possesses ordered C-terminal extensions in subunits NuoB, NuoI, and NuoF ranging from 22-45 residues in length, as well as a large 94-residue insertion loop in subunit NuoG (the G-loop) . These extensions adopt well-defined structures that line the surface of peripheral arm subunits with high shape complementarity, creating additional inter-subunit contacts with surface areas exceeding 1000 Ų in some cases . The G-loop fills a crevice between NuoCD, NuoI, and NuoG subunits, collectively increasing the interaction surface between the electron acceptor module (NuoEFG) and connecting module (NuoICDB) by a factor of three (from 1400 to 4600 Ų) . These structural adaptations stabilize the peripheral arm assembly and represent a novel evolutionary strategy for complex stabilization not observed in other Complex I homologs. The enhanced stability of the peripheral arm likely influences the conformational dynamics at the interface with membrane subunits including nuoK, potentially affecting the coupling mechanism between electron transfer and proton translocation.

What is the significance of the conserved glutamic acid residues in the nuoK subunit?

The conserved glutamic acid residues in the nuoK subunit, particularly Glu-36 and Glu-72, are functionally critical for the proton translocation activity of E. coli Complex I. Site-specific mutation studies have demonstrated that alterations to these residues profoundly impact the coupling mechanism. Mutations of the nearly perfectly conserved Glu-36 result in almost complete loss of coupled electron transfer activity, with a concomitant loss of electrochemical gradient generation . Similarly, mutations of the highly conserved Glu-72 cause significant diminution of coupled activities . Both of these acidic residues are predicted to be located in the middle of the membrane, positioning them ideally for participation in proton channels or the proton pumping machinery. The severe functional consequences of mutating these residues suggest they serve as key proton donors/acceptors within the membrane domain or participate in essential conformational changes required for proton translocation. The conservation of these glutamic acids across species further emphasizes their fundamental importance to the coupling mechanism that converts the energy of electron transfer to the mechanical work of proton pumping, representing critical functional elements within the nuoK subunit.

What are the most effective site-directed mutagenesis approaches for studying nuoK function?

The most effective site-directed mutagenesis approaches for studying nuoK function combine rational design based on sequence conservation analysis with precise genetic manipulation techniques. Researchers have successfully employed homologous recombination techniques to introduce site-specific mutations in the nuoK gene of the NDH-1 operon . This methodology allows for targeted alteration of specific amino acid residues while maintaining the gene in its natural genetic context with normal regulation. When selecting mutation targets, focusing on highly conserved residues across species provides the greatest insights into fundamental functional mechanisms. For example, targeting the nearly perfectly conserved Glu-36 or the highly conserved Glu-72 has revealed their critical importance in coupling electron transfer to proton translocation . Additionally, multiple substitution types at the same position (e.g., conservative vs. non-conservative replacements) can provide nuanced understanding of residue requirements. For cytosolic regions, simultaneous mutation of proximal residues, such as vicinal arginine residues, can uncover functional relationships that might not be apparent from single mutations . Following mutagenesis, a comprehensive analytical approach combining blue-native gel electrophoresis, immunostaining, activity assays measuring both electron transfer and proton pumping capabilities, and potentially structural analyses provides the most complete functional characterization of nuoK mutations.

How can researchers effectively purify and reconstitute Complex I to study nuoK in controlled environments?

Effective purification and reconstitution of Complex I for studying nuoK requires a multi-step approach that preserves structural integrity and functional activity. A successful methodology begins with genetic engineering of the nuo operon to introduce affinity tags, such as the Twin-Strep-tag at the N-terminus of a peripheral subunit like NuoF, using CRISPR-Cas9-enabled recombineering . This enables selective purification while maintaining native protein levels and complex assembly. Following cell growth and membrane preparation, solubilization with appropriate detergents that preserve the intact complex is critical—mild detergents like n-dodecyl-β-D-maltoside (DDM) at optimized concentrations maintain subunit interactions while extracting the complex from membrane lipids. Affinity chromatography using StrepTactin columns permits isolation of the intact complex, which can be further purified by size exclusion chromatography to ensure homogeneity. For functional studies, reconstitution into lipid nanodiscs provides a native-like membrane environment while maintaining accessibility for structural and functional analyses . This approach uses membrane scaffold proteins (MSPs) and specific lipid mixtures that mimic the bacterial inner membrane composition. The reconstituted complex should be validated for structural integrity by cryo-EM and functional activity through NADH:ubiquinone oxidoreductase assays and proton pumping measurements. This comprehensive methodology enables detailed investigation of nuoK within its native complex under controlled conditions.

What techniques are most appropriate for monitoring proton translocation activities linked to nuoK function?

Monitoring proton translocation activities linked to nuoK function requires specialized techniques that can detect the generation and maintenance of proton gradients across membranes. One of the most informative approaches is the measurement of electrochemical gradient generation using potentiometric probes such as Oxonol VI, which exhibits fluorescence changes in response to membrane potential . This method allows researchers to directly correlate electron transfer activities with the establishment of a membrane potential, providing crucial information about coupling efficiency. Another powerful technique involves reconstituting purified Complex I into liposomes loaded with pH-sensitive fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine. Upon initiation of Complex I activity by NADH addition, proton translocation into the liposome interior causes measurable fluorescence changes that directly quantify proton pumping efficiency. For more precise measurements of stoichiometry, researchers can employ pH electrode-based systems to monitor proton uptake or release in response to defined amounts of electron transfer. Additionally, real-time monitoring of both NADH oxidation (through absorbance at 340 nm) and proton translocation simultaneously provides direct correlation between these coupled activities. These methodologies are particularly valuable when comparing wild-type Complex I with variants containing specific nuoK mutations, allowing researchers to precisely define the contribution of individual residues to proton translocation function.

How does the pathogenicity island context of E. coli O6:K15:H31 influence research approaches to studying nuoK?

The association of E. coli O6:K15:H31 with a specific pathogenicity island (PAI) creates a unique context for nuoK research that must be considered in experimental design. The K15 capsule determinant of uropathogenic E. coli strain 536 (O6:K15:H31) is part of a novel 79.6-kb pathogenicity island designated PAI V536, which contains multiple virulence factors and is absent from non-pathogenic E. coli K-12 strains . This genomic context necessitates careful strain selection when studying nuoK, as pathogenic and non-pathogenic strains may exhibit different regulatory networks affecting nuo operon expression. Researchers must consider whether to study nuoK in its native pathogenic background to maintain authentic regulation and potential interactions with virulence factors, or to isolate the gene for expression in non-pathogenic laboratory strains to focus specifically on basic functional mechanisms. The pathogenicity island context also suggests potential lines of investigation regarding how nuoK function might contribute to virulence. For example, energy metabolism is critical during infection, and alterations in Complex I efficiency could impact bacterial survival in host environments. Methodologically, this contextual understanding guides genetic manipulation approaches, as homologous recombination techniques must account for sequence differences between pathogenic and laboratory strains . Additionally, the recognition that expression of the K15 capsule is important for virulence in urinary tract infection models but not for serum resistance provides a framework for interpreting nuoK function within the broader context of bacterial pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.