Recombinant Escherichia coli O6:K15:H31 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Introduction

Escherichia coli (E. coli) is a bacterium that includes both harmless and pathogenic strains . Certain serotypes of E. coli, such as O6:K15, can cause diseases . Pathogenic strains frequently have virulence factors like capsular polysaccharides, which are crucial for their ability to cause disease . Efflux pumps in E. coli contribute to antimicrobial resistance by expelling a wide array of compounds, including antibiotics, from the bacterial cell . The aaeA gene encodes a subunit of the p-hydroxybenzoic acid efflux pump, which is part of a system that helps the bacterium eliminate toxic compounds .

AaeA as Part of an Efflux Pump

AaeA forms an efflux pump with AaeB, which acts as a metabolic relief valve, eliminating certain compounds when they accumulate to high levels in the cell . Substrates for this pump include p-hydroxybenzoic acid (pHBA), 6-hydroxy-2-naphthoic, and 2-hydroxycinnamate .

Efflux Pumps in E. coli

Efflux pumps are vital for the bacterium E. coli, enabling it to resist multiple antimicrobials by facilitating the removal of a broad spectrum of compounds, such as antibiotics and heavy metals, from within the cell . Resistance-nodulation-cell division (RND) efflux pumps are responsible for extruding a broad range of compounds . Different energy sources can be used, depending on the efflux mechanism. ATP is used by ABC transporters, while MATE pumps are driven by $$Na^+/H^+$$ drug antiport systems . MFS, SMR, and RND pumps depend on the pH gradient .

AaeA and Pathogenicity Islands

The K15 capsule determinant is part of a 79.6-kb pathogenicity island (PAI) called PAI V536, which is not found in nonpathogenic E. coli K-12 strain MG1655 . PAI V536 contains the pix fimbriae determinant, genes coding for a putative phosphoglycerate transport system, an autotransporter protein, and hypothetical open reading frames .

Potential Functional Partners of AaeA

ProteinDescription
AaeBForms an efflux pump with AaeA; could function as a metabolic relief valve
AaeXBelongs to the AaeX family; putative inner membrane efflux pump-associated protein
AaeRActivates transcription of the aaeXAB operon; transcriptional regulator for aaeXAB operon
MacBPart of the tripartite efflux system MacAB-TolC; macrolide ABC transporter permease/ATPase
YeeZProtein involved in carbohydrate catabolic process; putative enzyme of sugar metabolism
EmrYPart of the tripartite efflux system EmrYK-TolC, which confers resistance to various drugs; putative multidrug efflux system
YdhKPutative efflux protein (PET) component of YdhJK efflux pump
EmrBPart of the tripartite efflux system EmrAB-TolC, which confers resistance to antibiotics; multidrug efflux system protein
TolCOuter membrane channel required for the function of several efflux systems; transport channel
YhcOBelongs to the barstar family; putative barnase inhibitor

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
aaeA; ECP_3325; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function

Forms an efflux pump in conjunction with AaeB.

Database Links

KEGG: ecp:ECP_3325

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA efflux pump subunit and what is its function in E. coli?

The AaeA protein (formerly known as YhcQ) functions as a membrane fusion protein component of the AaeAB efflux pump system in Escherichia coli. This pump specifically transports aromatic carboxylic acids across the bacterial membrane, with p-hydroxybenzoic acid (pHBA) being a primary substrate . The efflux pump consists of two essential components: AaeA (membrane fusion protein) and AaeB (efflux protein), which work together to expel potentially toxic compounds from the bacterial cell . The system is tightly regulated by the AaeR protein (formerly YhcS), a member of the LysR family of transcriptional regulators that controls expression of the aaeAB operon . Functionally, the AaeAB efflux system appears to serve as a "metabolic relief valve" that alleviates toxic effects resulting from imbalanced metabolism, protecting the bacterial cell from potentially harmful accumulations of aromatic carboxylic acids .

How is the aaeA gene organized within the E. coli genome?

The aaeA gene (formerly yhcQ) is located within a gene cluster that includes several functionally related genes. The organization follows a specific arrangement where aaeA is adjacent to aaeB (formerly yhcP), which encodes the efflux protein component of the pump . The gene cluster also includes aaeX (formerly yhcR), which encodes a small protein without a clearly defined function, and the divergently transcribed aaeR (formerly yhcS), which encodes the regulatory protein that controls expression of the efflux system . In E. coli O6:K15, the gene organization reflects its functional role in the bacterium's physiology, with genetic proximity facilitating coordinated expression of the components necessary for efflux activity . This genomic arrangement is consistent with other bacterial efflux systems where components of a functional complex are typically encoded in close proximity to enable efficient co-regulation and assembly of the complete transport machinery .

What induces expression of the aaeA gene in E. coli?

The expression of aaeA is primarily induced by exposure to aromatic carboxylic acids, with p-hydroxybenzoic acid (pHBA) serving as a particularly effective inducer . When E. coli cells are treated with pHBA, there is a significant upregulation of aaeA along with other genes in the aae operon . The induction process operates through the AaeR regulatory protein, which responds to the presence of aromatic carboxylic acids by activating transcription of the aaeXAB genes . Experimental evidence shows that several different aromatic carboxylic acid compounds can serve as inducers of aaeA expression, although only a limited subset of these compounds actually function as substrates for the efflux pump . The specificity of this induction mechanism suggests that the AaeAB system evolved to respond precisely to particular metabolic intermediates that might become toxic at high concentrations, providing a targeted defense mechanism rather than a broad-spectrum response to diverse compounds .

What are the phenotypic consequences of aaeA deletion in E. coli O6:K15?

Deletion of the aaeA gene in E. coli results in hypersensitivity to p-hydroxybenzoic acid (pHBA) and related aromatic carboxylic acids . Mutant strains lacking aaeA are unable to efficiently efflux these compounds, leading to intracellular accumulation and subsequent toxicity . Experimental studies have demonstrated that expression of both aaeA and aaeB is necessary and sufficient to restore tolerance to pHBA in mutant strains . The hypersensitivity phenotype is particularly pronounced under conditions where aromatic carboxylic acids are present at elevated concentrations, highlighting the critical role of the AaeAB efflux system in maintaining cellular homeostasis during metabolic stress . Interestingly, the phenotypic effects of aaeA deletion may vary depending on growth conditions and the specific aromatic compounds present, suggesting context-dependent functions for this efflux pump component .

How does the substrate specificity of the AaeAB efflux pump compare with other efflux systems in E. coli?

The AaeAB efflux pump demonstrates a remarkably narrow substrate specificity compared to many other bacterial efflux systems . Research has shown that out of hundreds of diverse compounds tested, only a few aromatic carboxylic acids were identified as substrates for this pump . This high selectivity contrasts sharply with multidrug efflux systems like AcrAB-TolC, which can transport a broad spectrum of structurally diverse compounds including antibiotics, detergents, and dyes . The substrate recognition determinants likely reside in both the AaeA and AaeB components, with specific protein domains involved in binding aromatic carboxylic acids . Comparative genomics and protein modeling suggest that the substrate-binding pocket of AaeB may have evolved to accommodate the planar aromatic ring structure common to its substrates while establishing specific interactions with the carboxylic acid moiety . This specialized function aligns with the proposed physiological role of AaeAB as a "metabolic relief valve" rather than a general defense mechanism against diverse environmental toxins .

What are the optimal methods for cloning and expressing recombinant AaeA protein?

For successful cloning and expression of recombinant AaeA protein from E. coli O6:K15:H31, several methodological considerations are crucial. The aaeA gene should be PCR-amplified using high-fidelity DNA polymerase with primers containing appropriate restriction sites for directional cloning into an expression vector . Expression vectors with inducible promoters (such as T7 or arabinose-inducible systems) are recommended to control protein production levels, as membrane proteins can be toxic when overexpressed . Since AaeA is a membrane fusion protein, expression hosts should be selected based on their ability to properly process membrane proteins—E. coli BL21(DE3) derivatives or C43/C41 strains are particularly suitable for this purpose . Expression conditions require careful optimization, with lower temperatures (16-25°C) and reduced inducer concentrations often yielding better results for membrane proteins by allowing proper folding and membrane insertion . For purification, a dual approach incorporating both a polyhistidine tag and a more specific affinity tag (such as Strep-tag II) can facilitate selective isolation of the recombinant protein while minimizing co-purification of contaminants .

What experimental approaches can determine the interaction between AaeA and AaeB proteins?

Investigating the molecular interactions between AaeA and AaeB requires multiple complementary experimental approaches. Bacterial two-hybrid systems can provide initial evidence of protein-protein interactions in vivo without requiring membrane extraction . Co-immunoprecipitation assays using antibodies against epitope-tagged versions of AaeA can pull down associated AaeB, confirming their physical interaction in membrane preparations . For detailed interaction mapping, crosslinking studies using chemical crosslinkers of various lengths can identify proximity relationships between specific protein domains . Advanced biophysical methods such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) can determine binding affinities between purified protein components or specific domains . Structural approaches including cryo-electron microscopy of the assembled complex would provide the most comprehensive visualization of the interaction interfaces . Functional complementation assays, where individual domains of AaeA are expressed in aaeA-deficient strains, can identify regions essential for proper interaction with AaeB and restoration of efflux activity .

How can researchers assess the transport kinetics of the AaeAB efflux pump?

Assessing transport kinetics of the AaeAB efflux pump requires specialized methodologies to measure substrate movement across bacterial membranes. One effective approach utilizes fluorescently labeled or radiolabeled aromatic carboxylic acid substrates to track their accumulation and efflux in real-time using intact cells or membrane vesicles . Time-course experiments measuring intracellular versus extracellular substrate concentrations can determine efflux rates under various conditions . For more detailed kinetic parameters, inside-out membrane vesicles containing the reconstituted AaeAB system allow measurement of ATP or proton gradient-dependent transport activities in a controlled environment . Substrate competition assays, where unlabeled compounds are tested for their ability to inhibit transport of a labeled substrate, can determine substrate specificity profiles and relative affinities . Advanced approaches might include development of FRET-based sensors that detect conformational changes during the transport cycle, providing insights into the mechanistic basis of efflux . These methodologies should be performed with appropriate controls, including AaeA or AaeB mutant strains and specific transport inhibitors, to confirm the specificity of measured activities .

What methods are effective for studying the regulation of aaeA expression?

Investigation of aaeA expression regulation requires a multi-faceted approach combining molecular genetics, biochemistry, and systems biology techniques. Reporter gene fusions, where the aaeA promoter is linked to easily measurable reporters like lacZ or fluorescent proteins, provide quantitative assessment of promoter activity under various conditions . Chromatin immunoprecipitation (ChIP) assays using antibodies against the AaeR regulator can identify in vivo binding sites and occupation patterns at the aaeA promoter . Electrophoretic mobility shift assays (EMSAs) with purified AaeR protein and labeled promoter fragments can confirm direct binding interactions and identify specific DNA recognition sequences . RNA-seq and quantitative RT-PCR provide precise measurements of aaeA transcript levels in response to various stimuli or genetic backgrounds . DNase I footprinting can map the exact nucleotides protected by AaeR binding, while in vitro transcription assays with purified components can reconstitute the regulatory mechanisms in a controlled setting . For comprehensive analysis, these approaches should be complemented with studies of potential small molecule ligands that modulate AaeR activity, using techniques like isothermal titration calorimetry (ITC) to measure binding parameters .

How should researchers interpret contradictory results in AaeA functional studies?

When encountering contradictory results in functional studies of AaeA, researchers should systematically evaluate several key factors that might contribute to these discrepancies. Strain-specific variations in genetic background can significantly impact efflux pump function and regulation, as demonstrated by the differences in stress response patterns between E. coli K-12 and O157:H7 strains . Researchers should carefully compare the specific E. coli serotypes used across studies, particularly noting differences between laboratory strains and clinical isolates like O6:K15:H31 . Experimental conditions, including growth media composition, pH, temperature, and growth phase, can dramatically alter efflux pump expression and activity patterns, necessitating standardized protocols for meaningful comparisons . The presence of potential crosstalking regulatory elements, such as global stress regulators that might influence aaeA expression differently under various conditions, should be considered when interpreting apparently conflicting results . Additionally, the techniques used to measure efflux activity (whole-cell assays versus membrane vesicle transport) may have different sensitivities and limitations that contribute to disparate observations . A comprehensive approach to resolving contradictions should include replication of key experiments under identical conditions, explicit consideration of genetic differences between strains, and application of multiple complementary methodologies to confirm functional characteristics .

What statistical approaches are appropriate for analyzing AaeA transport activity data?

Proper statistical analysis of AaeA transport activity data requires approaches tailored to the specific experimental designs used in efflux studies. For time-course measurements of substrate transport, repeated measures ANOVA or mixed-effects models are appropriate to account for the non-independence of sequential measurements from the same experimental units . When comparing transport activities across multiple strains or conditions, factorial ANOVA designs can evaluate main effects and interactions, with post-hoc tests (such as Tukey's HSD) to identify specific significant differences between groups . For substrate specificity profiling, where multiple compounds are tested for transport, multivariate methods such as principal component analysis or hierarchical clustering can identify patterns in substrate preferences . Michaelis-Menten kinetic parameters (Km and Vmax) for transport should be determined using nonlinear regression rather than linearization methods, with bootstrap confidence intervals to account for potential deviations from model assumptions . For all analyses, appropriate controls for multiple comparisons should be implemented to maintain family-wise error rates at acceptable levels . Researchers should also report effect sizes alongside p-values to communicate the magnitude of observed differences in transport activities, particularly when comparing mutant variants or different experimental conditions .

How can transcriptomic data be integrated to understand AaeA function in global stress responses?

Integrating transcriptomic data to understand AaeA's role in global stress responses requires sophisticated bioinformatic approaches that connect efflux pump expression with broader cellular adaptation mechanisms. Differential expression analysis comparing various stress conditions (acid, oxidative, antibiotic exposure) can identify co-regulation patterns between aaeA and other stress response genes . Weighted gene co-expression network analysis (WGCNA) can reveal modules of functionally related genes that respond similarly across conditions, potentially placing AaeA within specific stress response networks . Transcription factor binding site analysis of co-regulated genes can identify shared regulatory elements, suggesting potential integration of AaeA regulation with global stress regulators beyond AaeR . Pathway enrichment analysis of differentially expressed genes under conditions where aaeA is upregulated can connect efflux pump activity to specific metabolic or stress response pathways . For deeper integration, researchers should combine transcriptomic data with other omics approaches, such as metabolomics to identify potential endogenous substrates or proteomics to confirm translation of differentially expressed genes . The table below demonstrates how transcriptomic data comparing expression fold changes across different acidic conditions reveals distinct regulatory patterns that might influence efflux system function:

GeneStrainAcidulantMicroarray fold changeqRT-PCR fold change
gadEK-12HClNDE0.4 ± 0.1
Acetic acid-4.9-6.4 ± 1.2
Lactic acid-3.9-5.1 ± 0.7
O157:H7HClNDE0.7 ± 0.1
Acetic acidNDE0.8 ± 0.1
Lactic acidNDE1.6 ± 0.4

This comparative analysis demonstrates strain-specific responses to different acidulants that may provide insight into how efflux systems like AaeAB are integrated into broader stress response networks .

What are the considerations for interpreting structure-function relationships in AaeA protein?

Interpreting structure-function relationships in AaeA requires careful consideration of several methodological and biological factors. When analyzing structural data (whether from crystallography, cryo-EM, or predictive modeling), researchers must evaluate resolution limitations and potential artifacts introduced during protein purification or crystallization, particularly for membrane proteins that may adopt non-native conformations when extracted from their lipid environment . Sequence conservation analysis across diverse bacterial species can identify functionally critical residues that have been preserved through evolutionary pressure, providing strong candidates for mutagenesis studies . When interpreting the results of site-directed mutagenesis, researchers should distinguish between mutations that directly affect substrate binding or transport versus those that disrupt protein folding, oligomerization, or stability . The membrane topology of AaeA significantly influences its function, necessitating experimental verification of predicted transmembrane domains and periplasmic regions through approaches like cysteine accessibility scanning or reporter fusion analyses . Functional assays measuring transport activity should be correlated with structural features to develop mechanistic models, while considering that AaeA functions as part of a multiprotein complex where interactions with AaeB may induce conformational changes not observed in isolation . Additionally, researchers should consider the native lipid environment's influence on AaeA structure and function, as membrane protein activity can be significantly affected by lipid composition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.