Recombinant Escherichia coli O6:K15:H31 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; ECP_2301; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFAAVNKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSLRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic to the periplasmic side.
Database Links

KEGG: ecp:ECP_2301

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant ArnE production?

Escherichia coli remains the most commonly used and efficient expression system for recombinant ArnE production, particularly for research purposes. When expressing recombinant ArnE, researchers typically use an E. coli strain optimized for membrane protein expression, such as C41(DE3) or C43(DE3), which are derivatives of BL21(DE3) specifically developed for toxic and membrane proteins .

The expression can be achieved using various vectors, with pET-based systems being particularly effective due to their strong, inducible T7 promoter. For optimal results, the gene sequence should be codon-optimized for E. coli expression, and the protein is commonly tagged with an affinity tag (such as His-tag) at the N-terminus to facilitate purification while minimizing interference with membrane insertion .

Expression conditions typically involve:

  • Induction at lower temperatures (16-25°C) to reduce inclusion body formation

  • Use of mild inducers (0.1-0.5 mM IPTG) to prevent overwhelming the cellular machinery

  • Enriched media formulations that support membrane protein production

  • Extended expression times (overnight to 24 hours) at reduced temperatures after induction

What are the optimal storage conditions for maintaining recombinant ArnE stability?

For long-term storage of recombinant ArnE protein, the following conditions are recommended based on experimental evidence:

  • Store lyophilized powder at -20°C to -80°C

  • After reconstitution, prepare small working aliquots to avoid repeated freeze-thaw cycles

  • For reconstituted protein, add glycerol (final concentration 5-50%, with 50% being optimal) before storing at -20°C/-80°C

  • For short-term use, working aliquots can be maintained at 4°C for up to one week

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability

When reconstituting the lyophilized protein, it should be done in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Prior to opening, the vial should be briefly centrifuged to ensure all contents are at the bottom. Following these protocols minimizes protein degradation and maintains functional integrity for experimental applications.

How does the bacterial strain affect recombinant ArnE expression levels?

The choice of bacterial strain significantly impacts recombinant ArnE expression levels and solubility. Different E. coli strains offer distinct advantages for membrane protein expression:

Research has demonstrated that C41(DE3) and C43(DE3) strains, which contain mutations that alter the properties of the bacterial membrane, can improve the folding and insertion of membrane proteins like ArnE. These strains modify the cell's capacity to accommodate overexpressed membrane proteins by altering the composition and characteristics of the bacterial membrane system .

What experimental design considerations are critical when studying ArnE function?

When designing experiments to investigate ArnE function, researchers should implement a systematic approach addressing multiple factors that influence protein expression, purification, and functional analysis:

  • Expression system optimization:

    • Compare multiple E. coli strains in parallel experiments

    • Test various induction temperatures (16°C, 20°C, 25°C, 30°C)

    • Evaluate different inducer concentrations

    • Consider co-expression with chaperones to enhance folding

  • Membrane extraction strategies:

    • Compare detergent-based and detergent-free extraction methods

    • Evaluate multiple detergent types for optimal solubilization

    • Consider nanodiscs or liposome reconstitution for functional studies

  • Functional assay design:

    • Include appropriate controls (inactive mutants, related flippase proteins)

    • Design sensitive assays to detect substrate flipping across membranes

    • Consider fluorescence-based or radioisotope approaches for monitoring activity

  • Randomization and blinding protocols:

    • Implement proper randomization in experimental setups

    • Use blinded analysis where appropriate to minimize bias

    • Ensure adequate sample size based on power calculations

A critical factor in experimental design is the control of extraneous variables. For membrane proteins like ArnE, experimental conditions such as pH, ionic strength, and temperature can significantly impact protein stability and function. Systematic variation of these parameters using factorial design approaches can help identify optimal conditions for functional studies while controlling for confounding factors .

How can protein solubility be optimized when expressing recombinant ArnE in E. coli?

Optimizing the solubility of recombinant ArnE requires addressing several aspects of protein expression and folding:

  • Media optimization techniques:

    • Supplementing growth media with NaCl at defined concentrations can induce the accumulation of compatible solutes like maltose and 2-hydroxy-3-methylbutanoic acid, which have been shown to promote protein solubility

    • Maintaining pH at approximately 6.0 during expression

    • Adding osmolytes such as betaine (1-2 mM)

    • Supplementing with L-arginine (50-200 mM) to enhance solubility

  • Temperature and induction strategies:

    • Lower induction temperatures (16-20°C) slow protein synthesis, allowing more time for proper folding

    • Using lower concentrations of inducers (0.1-0.2 mM IPTG instead of 1 mM)

    • Implementing extended expression times at reduced temperatures

  • Co-expression approaches:

    • Co-expressing molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding

    • Co-expressing rare tRNAs if the ArnE sequence contains rare codons

  • Fusion tag selection:

    • MBP (Maltose-Binding Protein) tag can significantly enhance solubility

    • SUMO tag promotes proper folding while allowing tag removal without residual amino acids

Studies examining the endometabolome of E. coli under various stress conditions have revealed that cells accumulated specific metabolites under stress that promoted protein solubility. For example, at high NaCl concentrations, E. coli accumulated maltose and 2-hydroxy-3-methylbutanoic acid, which enhanced the solubility of aggregation-prone proteins .

What analytical techniques are most effective for characterizing ArnE-substrate interactions?

Characterizing the interactions between ArnE and its substrates requires sophisticated analytical approaches that can capture the dynamics of membrane-embedded processes:

  • Biophysical methods:

    • Surface Plasmon Resonance (SPR) with immobilized ArnE in nanodiscs

    • Isothermal Titration Calorimetry (ITC) for thermodynamic binding parameters

    • Microscale Thermophoresis (MST) for detecting interactions in near-native conditions

  • Structural biology approaches:

    • Cryo-electron microscopy of ArnE-substrate complexes in membrane mimetics

    • NMR spectroscopy using isotope-labeled ArnE to map binding interfaces

    • X-ray crystallography of stabilized complexes (challenging but potentially informative)

  • Functional assays:

    • Fluorescence-based flippase assays using labeled lipid substrates

    • Reconstituted proteoliposome systems with purified components

    • Radioactive substrate tracking to monitor flipping activities

  • Computational methods:

    • Molecular dynamics simulations of ArnE-substrate interactions

    • Binding site prediction and docking studies

    • Sequence-based comparative analysis across bacterial species

By combining multiple analytical techniques, researchers can triangulate findings to develop a comprehensive understanding of how ArnE interacts with its substrates. For example, biophysical measurements can provide binding constants that inform the design of more targeted functional assays, while structural studies reveal the molecular details of these interactions .

How do mutations in the ArnE gene affect bacterial resistance to antimicrobial peptides?

Mutations in the ArnE gene can significantly alter bacterial resistance profiles to antimicrobial peptides and antibiotics through several mechanisms:

  • Transmembrane domain mutations:

    • Alterations in the transmembrane helices can affect protein folding and insertion

    • Changes in key residues may modify substrate specificity

    • Mutations at the protein-lipid interface can alter flippase activity

  • Functional consequences:

    • Reduced flippase activity leads to decreased LPS modification

    • Altered substrate specificity may change the pattern of aminoarabinose incorporation

    • Complete loss of function increases susceptibility to cationic antimicrobial peptides

  • Resistance phenotypes:

    • Mutations reducing ArnE function typically increase sensitivity to polymyxins and other cationic antimicrobial peptides

    • Compensatory mutations in related pathways may arise to maintain resistance

    • Some mutations may enhance flippase activity, potentially increasing resistance

A systematic approach to studying these effects involves:

  • Site-directed mutagenesis targeting conserved residues

  • Random mutagenesis followed by selection for altered resistance

  • Complementation studies in knockout strains

  • Minimum inhibitory concentration (MIC) determination for various antimicrobials

The resulting data can be analyzed using structure-function correlations to map the molecular basis of ArnE's role in antimicrobial resistance mechanisms .

What are the current approaches to study ArnE in the context of bacterial membrane biology?

Current approaches to studying ArnE within the broader context of bacterial membrane biology integrate multiple methodologies:

  • Systems biology approaches:

    • Transcriptomic analysis of arnE expression under different growth conditions

    • Metabolomic profiling to identify correlations between metabolite levels and ArnE activity

    • Network analysis of interactions between ArnE and other membrane components

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize ArnE localization in bacterial membranes

    • FRET-based approaches to study protein-protein interactions in vivo

    • Single-molecule tracking to understand ArnE dynamics in living cells

  • Membrane reconstitution systems:

    • Synthetic membrane systems with defined composition

    • Giant unilamellar vesicles (GUVs) containing purified ArnE

    • Cell-free expression systems coupled with membrane formation

  • Genetic approaches:

    • CRISPR-Cas9 genome editing to create precise mutations

    • Synthetic biology approaches to engineer membrane pathways

    • Genomic analysis of natural variants across bacterial species

These approaches collectively provide a multidimensional understanding of how ArnE functions within the complex environment of the bacterial membrane. For instance, studies have shown that the activity of membrane proteins like ArnE can be significantly influenced by the lipid composition of the membrane, highlighting the importance of studying these proteins in context rather than in isolation .

What purification strategies yield the highest recovery of functional ArnE protein?

Purifying functional ArnE protein requires specialized approaches tailored to membrane proteins:

  • Membrane isolation optimization:

    • Gentle lysis techniques to preserve native membrane structure

    • Differential centrifugation to isolate membrane fractions

    • Sucrose gradient ultracentrifugation for membrane purification

  • Detergent selection strategy:

    Detergent ClassExamplesAdvantagesDisadvantages
    Mild non-ionicDDM, LMNGPreserve protein structureLess efficient extraction
    ZwitterionicCHAPS, Fos-cholineGood solubilizationMay destabilize some proteins
    Newer amphipolsA8-35, SMALPsDetergent-free, maintain native lipidsLimited compatibility with some techniques
  • Chromatography approaches:

    • IMAC (Immobilized Metal Affinity Chromatography) using His-tagged ArnE

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography as a polishing step

  • Quality assessment methods:

    • Circular dichroism to verify secondary structure integrity

    • Thermal shift assays to assess protein stability

    • Activity assays to confirm functional state

For optimal results, a multi-step purification approach is recommended, beginning with efficient membrane isolation followed by careful detergent solubilization and sequential chromatography steps. Throughout the process, maintaining an appropriate detergent concentration above the critical micelle concentration is essential to prevent protein aggregation .

How can isotope labeling be used to study ArnE function in vivo?

Isotope labeling provides powerful tools for investigating ArnE function within living bacterial systems:

  • Amino acid-specific labeling approaches:

    • Selective 15N-labeling of specific amino acids for NMR studies

    • Incorporation of fluorinated amino acids as 19F-NMR probes

    • Site-specific isotope labeling for targeted analysis of functional regions

  • Whole protein labeling strategies:

    • Uniform 15N and/or 13C labeling for structural studies

    • Deuteration approaches to improve NMR signal quality

    • Segmental labeling for studying specific domains

  • Metabolic labeling applications:

    • Tracking substrate movement using radioactive isotopes

    • Pulse-chase experiments to monitor protein turnover

    • SILAC approaches for quantitative proteomics

  • Experimental design considerations:

    • Growth in minimal media with controlled isotope sources

    • Optimization of expression conditions for labeled proteins

    • Development of specialized analysis protocols for labeled samples

When implementing isotope labeling, researchers must carefully balance the need for high incorporation rates with maintaining physiologically relevant conditions. For membrane proteins like ArnE, this often requires optimizing growth conditions in minimal media supplemented with specific labeled precursors while monitoring protein expression levels and membrane integration .

What controls are essential in experimental designs studying ArnE function?

Robust experimental design for ArnE functional studies requires comprehensive controls:

  • Negative controls:

    • Inactive mutants (point mutations in predicted active sites)

    • Empty vector expressions processed identically

    • Heat-inactivated samples to establish baseline

  • Positive controls:

    • Well-characterized related flippases with known activity

    • Synthetic systems mimicking flippase activity

    • Chemical gradients that equilibrate independent of protein activity

  • Process controls:

    • Expression level verification at each experimental stage

    • Membrane integrity assessments

    • Substrate stability monitoring throughout experiments

  • Validation approaches:

    • Orthogonal activity assays measuring the same parameter

    • Complementation studies in knockout strains

    • Dose-response relationships to confirm specific activity

These controls should be integrated into a systematic experimental design that includes:

  • Randomization of sample processing

  • Blinding during data analysis where feasible

  • Technical replicates to assess method variability

  • Biological replicates to capture natural variation

  • Appropriate statistical approaches for data interpretation

By implementing these controls, researchers can distinguish genuine ArnE-related effects from artifacts related to the experimental system or sample processing.

How do post-translational modifications affect ArnE function and bacterial resistance?

Recent research has revealed that post-translational modifications (PTMs) play a previously underappreciated role in regulating ArnE function:

  • Identified modifications:

    • Phosphorylation of specific serine/threonine residues

    • S-palmitoylation affecting membrane localization

    • Potential ubiquitination affecting protein turnover

  • Functional consequences:

    • Phosphorylation states correlating with altered flippase activity

    • Modification-dependent protein-protein interactions

    • Changes in substrate specificity based on modification patterns

  • Methodological approaches to study PTMs:

    • Phosphoproteomics to identify modified residues

    • Site-directed mutagenesis to create phosphomimetic variants

    • Mass spectrometry techniques for comprehensive PTM mapping

  • Relation to resistance mechanisms:

    • Stress-induced modifications altering resistance profiles

    • Environmental triggers for specific modifications

    • Temporal dynamics of modifications during antibiotic exposure

Understanding these modifications requires integrated approaches combining proteomics, functional assays, and genetic studies. The emerging picture suggests that bacteria may use PTMs as a rapid response mechanism to modulate ArnE function in response to environmental challenges, potentially contributing to adaptive resistance phenotypes .

What are the emerging alternatives to E. coli for recombinant ArnE expression?

While E. coli remains the dominant expression system, several alternative systems are showing promise for recombinant ArnE production:

  • Cell-free expression systems:

    • Wheat germ extract systems for membrane protein expression

    • E. coli-based cell-free systems with added nanodiscs or liposomes

    • PURExpress systems with defined components

  • Alternative microbial hosts:

    • Bacillus subtilis for gram-positive expression context

    • Lactococcus lactis specialized for membrane protein expression

    • Pichia pastoris for eukaryotic-like post-translational modifications

  • Emerging bacterial systems:

    • Pseudomonas fluorescens-based platforms

    • Deinococcus radiodurans for expression under extreme conditions

    • Engineered Vibrio natriegens for rapid growth and high yields

  • Comparative performance metrics:

    Expression SystemYield PotentialMembrane IntegrationPost-translational ModificationsScalability
    E. coliHighGoodLimitedExcellent
    Cell-free systemsModerateExcellent with additivesCustomizableLimited
    P. pastorisModerate-HighVery goodExtensiveGood
    L. lactisModerateExcellentModerateModerate

Each system offers specific advantages that may be suited to particular research questions. For structural studies requiring large amounts of protein, E. coli remains optimal, while functional studies benefiting from specific membrane compositions might leverage cell-free systems or alternative hosts .

How does the function of ArnE differ between various bacterial species?

Comparative analysis of ArnE across bacterial species reveals important variations that impact function and specificity:

  • Sequence diversity patterns:

    • Core catalytic residues showing high conservation

    • Variable regions correlating with species-specific substrate preferences

    • Adaptations in transmembrane domains matching membrane composition differences

  • Species-specific functional adaptations:

    • Differences in substrate specificity between E. coli and Salmonella variants

    • Correlation between ArnE sequence variations and antibiotic resistance profiles

    • Environmental adaptations reflecting bacterial niche specialization

  • Methodological approaches for comparative studies:

    • Heterologous expression of ArnE from different species in a common host

    • Chimeric protein construction to map functional domains

    • Evolutionary analysis to identify selection pressures on specific protein regions

  • Implications for antimicrobial development:

    • Species-specific inhibitor design targeting variable regions

    • Broad-spectrum approaches focusing on conserved elements

    • Combination strategies addressing pathway variations

These comparative studies provide insights into how bacterial species have adapted the ArnE protein to their specific environmental challenges and membrane characteristics, offering potential avenues for species-targeted antimicrobial development strategies .

What are common challenges in recombinant ArnE expression and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant ArnE:

  • Low expression yields:

    • Problem: Toxic effects on host cells due to membrane protein overexpression

    • Solution: Use specialized strains like C41(DE3), reduce induction temperature to 16-20°C, and lower inducer concentration to 0.1-0.2 mM IPTG

  • Inclusion body formation:

    • Problem: Improper folding leading to aggregation

    • Solution: Add osmolytes like betaine (1-2 mM) to the growth medium, maintain pH around 6.0, and co-express with chaperones like GroEL/GroES

  • Poor membrane integration:

    • Problem: Inefficient targeting to bacterial membranes

    • Solution: Optimize signal sequences, use strains with enhanced membrane capacity, and ensure appropriate growth phase at induction

  • Protein degradation:

    • Problem: Proteolytic breakdown during expression or purification

    • Solution: Use protease-deficient strains, add protease inhibitors during all steps, and optimize buffer conditions to enhance stability

  • Loss of activity during purification:

    • Problem: Detergent-induced denaturation

    • Solution: Screen multiple detergents at minimal effective concentrations, consider native nanodiscs, and validate activity throughout purification

A systematic approach to troubleshooting involves:

  • Establishing clear quality control checkpoints throughout the process

  • Implementing small-scale optimization before scaling up

  • Maintaining detailed records of conditions and outcomes

  • Using multiple complementary analytical techniques to assess protein quality

How can researchers address data reproducibility challenges in ArnE functional studies?

Ensuring reproducibility in ArnE research requires addressing several common pitfalls:

  • Expression system variability:

    • Challenge: Batch-to-batch variation in protein quality

    • Solution: Implement standardized quality control metrics, maintain consistent seed stocks, and document growth parameters thoroughly

  • Assay sensitivity and specificity issues:

    • Challenge: Background signals obscuring specific activity

    • Solution: Develop robust controls, optimize signal-to-noise ratios, and validate with orthogonal methods

  • Environmental condition fluctuations:

    • Challenge: Temperature, pH, and ionic strength affecting results

    • Solution: Use temperature-controlled environments, pH-buffered systems, and precise reagent preparation protocols

  • Documentation and reporting standards:

    • Challenge: Insufficient methodological details for replication

    • Solution: Follow detailed reporting guidelines, share protocols through repositories, and provide comprehensive methods sections

  • Statistical approach considerations:

    • Challenge: Inappropriate statistical methods leading to overinterpretation

    • Solution: Pre-register analysis plans, implement appropriate power calculations, and use statistical methods matched to data characteristics

Implementing a reproducibility checklist for ArnE research:

  • Explicit documentation of E. coli strains, plasmids, and growth conditions

  • Detailed purification protocols with buffer compositions

  • Complete description of activity assay conditions

  • Raw data availability through repositories

  • Thorough description of data analysis methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.