Recombinant Escherichia coli O6:K15:H31 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Introduction to ArnF in Escherichia coli O6:K15:H31

Recombinant Escherichia coli O6:K15:H31 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) is a membrane-associated protein involved in lipid A modification, a critical mechanism for bacterial resistance to cationic antimicrobial peptides (CAMPs) and polymyxins . This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose (L-Ara4N)-modified undecaprenyl phosphate across the inner membrane, enabling the covalent attachment of L-Ara4N to lipid A . ArnF is encoded within pathogenicity islands of uropathogenic E. coli strains like O6:K15:H31, contributing to virulence and host adaptation .

Genomic Organization

ArnF is encoded within a 79.6-kb pathogenicity island (PAI V536) linked to the pheV tRNA gene in E. coli O6:K15:H31 . This PAI also harbors:

  • Virulence factors: Hemolysin (hly), P-related fimbriae (prf), and capsule biosynthesis genes (kps) .

  • Regulatory elements: Cross-talk between adhesin genes (e.g., sfa, pil) enhances biofilm formation and serum resistance .

Capsule Biosynthesis Linkage

The K15 capsular polysaccharide of E. coli O6:K15:H31 contains 4)-α-GlcpNAc-(1→5)-α-KDOp-(2→ repeats, partially acetylated at GlcNAc . While ArnF is not directly involved in K15 synthesis, its role in lipid A modification enhances membrane stability, indirectly supporting capsule-mediated immune evasion .

Functional Role in Antimicrobial Resistance

ArnF operates as part of the ArnEF translocon with ArnE, flipping undecaprenyl phosphate-α-L-Ara4N to the periplasmic leaflet for transfer to lipid A via ArnT . Key findings:

  • Mechanism: ATP-independent flippase activity confirmed via lipid transport assays .

  • Phenotypic Impact:

    • ΔarnF mutants show 50–70% reduced L-Ara4N lipid A modification .

    • Contributes to polymyxin resistance (MIC reduction from >64 µg/mL to 2 µg/mL in mutants) .

Expression and Purification

Recombinant ArnF is expressed in E. coli with an N-terminal His-tag, yielding soluble protein for biochemical studies . Critical steps include:

  • Lyophilization: Stabilizes the protein for long-term storage at -80°C .

  • Homologs: Orthologs in Salmonella typhi (Q8Z537) and Proteus mirabilis (B4ETM1) share 67–72% sequence identity .

Research Applications

  • Drug Discovery: Target for disrupting lipid A modification in multidrug-resistant pathogens .

  • Structural Studies: Used in crystallography and molecular dynamics simulations to map flippase mechanisms .

Evolutionary and Clinical Significance

ArnF homologs are conserved in Enterobacteriaceae, suggesting a shared mechanism for lipid A modification . In E. coli O6:K15:H31, ArnF’s association with pathogenicity islands underscores its role in urinary tract infections (UTIs) and sepsis . Strains lacking arnF exhibit attenuated virulence in murine models, highlighting its therapeutic potential .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific requirements. Please indicate your desired format during order placement, and we will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All protein shipments are standardly packaged with regular blue ice packs. If dry ice packaging is required, please inform us in advance for necessary arrangements and associated fees.
Notes
Repeated freezing and thawing cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during the production process. Should you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnF; ECP_2302; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
arnF
Target Protein Sequence
MGLMWGLFSVIIASAAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function
The protein acts as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic side to the periplasmic side.
Database Links

KEGG: ecp:ECP_2302

Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of ArnF in Escherichia coli?

ArnF functions as a subunit of the flippase complex responsible for translocating 4-amino-4-deoxy-L-arabinose (Ara4N)-modified lipids across the bacterial membrane. This process is part of a larger pathway that modifies bacterial lipopolysaccharide (LPS) through the addition of Ara4N to lipid A phosphate groups. This modification is crucial for bacterial resistance to polymyxin and other cationic antimicrobial peptides by reducing the negative charge of the bacterial outer membrane. The Ara4N modification pathway involves several proteins encoded by the arn operon, with ArnF working in concert with other components to facilitate the transfer and incorporation of Ara4N into the LPS structure. The pathway begins with the ArnA-catalyzed oxidation and decarboxylation of UDP-glucuronic acid, followed by ArnB-mediated transamination to generate UDP-L-Ara4N, which is eventually transferred to lipid A via ArnT transferase .

How does the Arn pathway contribute to antimicrobial resistance?

The Arn pathway contributes to antimicrobial resistance by modifying the lipopolysaccharide structure to reduce bacterial susceptibility to cationic antimicrobial peptides. The addition of 4-amino-4-deoxy-L-arabinose (Ara4N) to the phosphate groups of lipid A neutralizes the negative charge of the bacterial outer membrane, thereby reducing the electrostatic attraction between positively charged antimicrobial peptides and the bacterial surface. This modification is particularly important for resistance to polymyxin antibiotics, which are often used as last-resort treatments for multidrug-resistant gram-negative infections. Research has confirmed that in both Escherichia coli and Salmonella typhimurium, this modification is required for polymyxin resistance . The complete pathway involves multiple enzymes, including ArnA (for oxidation and decarboxylation), ArnB (for transamination), and ArnT (for the final transfer), with ArnF playing a crucial role in the transport process across the membrane.

What expression systems are commonly used for recombinant production of ArnF?

For recombinant production of membrane proteins like ArnF, specialized Escherichia coli expression systems are commonly employed. The pET expression system, which utilizes T7 RNA polymerase under the control of the lac promoter, is frequently used for controlled expression of recombinant proteins in E. coli . For membrane proteins that may cause toxicity when overexpressed, strains with specific modifications can be particularly valuable. For instance, E. coli strains with deletions in RNase E, such as SuptoxRNE22, have been shown to efficiently suppress membrane protein-induced toxicity and achieve enhanced levels of recombinant membrane protein production .

The expression protocol typically involves the following steps:

  • Cloning the arnF gene into an appropriate vector with a C-terminal polyhistidine tag

  • Transformation into an E. coli expression strain

  • Induction of protein expression under controlled conditions

  • Cell harvesting and membrane fraction isolation

  • Solubilization of the membrane protein using appropriate detergents

  • Purification via nickel-NTA affinity chromatography

This approach has been used successfully for similar membrane proteins involved in lipopolysaccharide modification pathways .

What are the key challenges in expressing functional ArnF protein?

Expressing functional ArnF protein presents several challenges typical of membrane protein production in recombinant systems. The primary challenges include:

  • Cytotoxicity: Overexpression of membrane proteins often causes severe toxicity to the host cells, resulting in poor growth and low yields. This is particularly relevant for proteins involved in lipid transport like ArnF. To address this, specialized E. coli strains like SuptoxR or SuptoxRNE22 can be used, which are designed to suppress membrane protein-induced toxicity and achieve enhanced levels of recombinant membrane protein production .

  • Protein folding and membrane integration: Ensuring proper folding and integration into the membrane is critical for obtaining functional ArnF. This requires optimization of expression conditions, including temperature, induction time, and inducer concentration.

  • Protein solubilization and purification: Extracting membrane proteins while maintaining their native conformation requires careful selection of detergents and buffer conditions. A balance must be struck between efficiently solubilizing the protein and maintaining its structure and function.

  • Post-translational modifications: While E. coli has limitations in performing certain post-translational modifications, recent advances have improved glycosylation pathways and the production of proteins requiring disulfide bonds .

To optimize expression, researchers should consider strain selection, vector design, growth conditions, and purification strategies tailored specifically for membrane proteins.

How can fluorescence microscopy be used to study ArnF localization in E. coli?

Fluorescence microscopy offers a powerful approach to study ArnF localization in living E. coli cells. The methodology involves creating a fusion protein with ArnF linked to a fluorescent reporter protein, such as mCherry, followed by expression in E. coli and visualization using fluorescence microscopy. This approach has been successfully employed for studying the localization of other bacterial proteins, such as RecN .

The experimental workflow includes:

  • Construction of fluorescent fusion proteins: The arnF gene can be amplified from E. coli strains (such as MG1655) and fused with mCherry at either the C- or N-terminus, with consideration for potential interference with protein function. This fusion construct is then cloned into an expression vector like pET21a under the control of the lac promoter .

  • Expression in appropriate E. coli strains: The constructs are transformed into suitable E. coli strains, and protein expression is induced under controlled conditions.

  • Live-cell imaging protocol:

    • Bacterial cultures are grown to mid-log phase

    • Cells are harvested by gentle centrifugation

    • Cell suspensions are placed on agarose pads for immobilization

    • Imaging is performed using a fluorescence microscope with appropriate filters

  • Data analysis: Analysis of subcellular localization patterns, including potential membrane association and clustering behavior. Quantitative analysis of fluorescence intensity distributions can provide insights into the dynamics of protein localization.

This approach can reveal important information about ArnF's distribution within the cell membrane and its potential co-localization with other components of the Ara4N modification machinery, offering insights into the spatial organization of this resistance mechanism .

What methods can be used to assess the flippase activity of ArnF in vitro?

Assessing the flippase activity of ArnF in vitro requires specialized methods to monitor the translocation of lipid-linked Ara4N across membranes. Several complementary approaches can be employed:

  • Reconstitution in proteoliposomes: Purified ArnF can be reconstituted into proteoliposomes with fluorescently labeled lipid analogs that mimic the natural substrate. The flippase activity can then be measured by monitoring the accessibility of the fluorescent lipids to membrane-impermeant quenching agents or proteases.

  • Synthetic substrate utilization: Chemical synthesis of phosphodiester-linked lipid Ara4N derivatives, similar to those described for ArnT assays, can provide suitable substrates for studying ArnF activity. These synthetic substrates can include various lipid chains, such as linear aliphatic chains or E- and Z-configured monoterpene units . The transfer reaction can be monitored using:

    • Thin-layer chromatography (TLC)

    • Liquid chromatography coupled with mass spectrometry (LC-ESI-QTOF MS)

  • ATP hydrolysis assays: If ArnF requires ATP for its flippase activity (as many flippases do), an ATP hydrolysis assay can be used as an indirect measure of activity. This can be performed using:

    • Colorimetric methods to detect inorganic phosphate release

    • Coupled enzyme assays with ATP regeneration systems

  • Membrane vesicle assays: Inside-out membrane vesicles prepared from E. coli expressing ArnF can be used to study the directionality of transport and substrate specificity.

These methods can be complemented with structural studies and mutational analyses to gain deeper insights into the mechanism of ArnF-mediated lipid translocation and its role in antimicrobial resistance.

How do mutations in ArnF affect lipopolysaccharide modification and antimicrobial resistance?

Mutations in ArnF can significantly impact lipopolysaccharide modification and consequently alter antimicrobial resistance profiles in Escherichia coli. To systematically study these effects, researchers can employ the following methodological approach:

  • Site-directed mutagenesis: Generate specific mutations in conserved regions of ArnF, particularly targeting:

    • Predicted transmembrane domains

    • ATP-binding motifs (if present)

    • Potential substrate recognition sites

    • Interface regions for interaction with other Arn proteins

  • Complementation studies: Express mutant ArnF variants in arnF-deficient strains and assess their ability to restore Ara4N modification and polymyxin resistance.

  • Lipopolysaccharide analysis: Extract and analyze LPS from strains expressing wild-type or mutant ArnF using:

    • Mass spectrometry to detect Ara4N modifications

    • NMR spectroscopy for structural confirmation

    • Electrophoretic mobility assays to assess charge alterations

  • Antimicrobial susceptibility testing: Determine minimum inhibitory concentrations (MICs) for polymyxin and other cationic antimicrobial peptides in strains expressing different ArnF variants.

  • Protein-protein interaction studies: Investigate how mutations affect interactions between ArnF and other components of the Ara4N modification machinery using:

    • Co-immunoprecipitation

    • Bacterial two-hybrid assays

    • Fluorescence resonance energy transfer (FRET)

Such comprehensive analyses can provide insights into the structure-function relationships of ArnF and potentially identify critical domains that could be targeted for the development of novel antimicrobial strategies aimed at inhibiting the Ara4N modification pathway and restoring antibiotic susceptibility.

What is the relationship between ArnF expression levels and bacterial fitness under different growth conditions?

The relationship between ArnF expression levels and bacterial fitness is complex and context-dependent, requiring sophisticated experimental approaches to elucidate. A comprehensive methodology to investigate this relationship would include:

  • Controlled expression systems: Develop strains with titratable expression of ArnF using:

    • Inducible promoters with varying inducer concentrations

    • Promoters of different strengths

    • Ribosome binding sites with different translation efficiencies

  • Growth fitness measurements under various conditions:

    • Standard laboratory media (minimal vs. rich)

    • Different pH environments (acidic, neutral, alkaline)

    • Presence of subinhibitory concentrations of various antimicrobials

    • Nutrient limitation conditions

    • Presence of physiologically relevant stresses (oxidative, osmotic)

  • Competition assays: Perform mixed culture experiments with strains expressing different levels of ArnF to directly measure relative fitness:

    • Use fluorescent markers for strain differentiation

    • Implement flow cytometry for quantification

    • Calculate selection coefficients across multiple generations

  • Metabolic burden assessment: Measure the metabolic impact of ArnF expression by:

    • Respiration rate measurements

    • ATP level quantification

    • Growth rate and yield calculations

    • Transcriptome and proteome analysis to identify compensatory mechanisms

  • In vivo fitness measurements: Extend studies to animal infection models to assess the impact of ArnF expression on:

    • Colonization efficiency

    • Persistence during infection

    • Competition with wild-type strains in host environments

This approach would provide a comprehensive understanding of how ArnF expression affects bacterial fitness across different environmental contexts, offering insights into the evolutionary trade-offs associated with antimicrobial resistance mechanisms based on LPS modification. This understanding is critical for predicting the emergence and persistence of resistant strains in clinical and environmental settings .

How does the interaction between ArnF and other components of the Arn pathway facilitate 4-amino-4-deoxy-L-arabinose transfer?

The interaction between ArnF and other components of the Arn pathway forms a sophisticated molecular machinery that enables the efficient transfer of 4-amino-4-deoxy-L-arabinose (Ara4N) to lipopolysaccharide. To investigate these interactions, researchers can employ multiple complementary methodologies:

  • Protein-protein interaction mapping:

    • Co-immunoprecipitation with tagged ArnF

    • Bacterial two-hybrid screening

    • Chemical cross-linking followed by mass spectrometry

    • Surface plasmon resonance to determine binding affinities

  • Functional reconstitution studies:

    • Membrane protein co-purification

    • Reconstitution of multiple Arn proteins in proteoliposomes

    • Activity assays with defined component combinations to identify the minimal functional unit

  • Structural biology approaches:

    • Cryo-electron microscopy of the ArnF-containing complex

    • X-ray crystallography of individual components and subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • In situ localization:

    • Fluorescence microscopy with differentially labeled Arn proteins to assess co-localization

    • Single-molecule tracking to determine dynamic interactions

    • Super-resolution microscopy to visualize nanoscale organization

Based on the available research on related systems, a proposed model of interaction would include ArnB (aminotransferase) generating UDP-L-Ara4N in the cytoplasm , followed by processing and transport steps involving ArnF as part of the flippase machinery that translocates the Ara4N-containing intermediates across the membrane, ultimately allowing ArnT to catalyze the final transfer to lipid A. The specificity of these interactions is likely critical for ensuring that only the correct substrate is modified, as demonstrated by studies showing that only specific lipid derivatives are accepted by the Ara4N transfer machinery .

What are the structural determinants of substrate specificity in ArnF-mediated lipid translocation?

Understanding the structural determinants of substrate specificity in ArnF-mediated lipid translocation requires a multifaceted approach combining biochemical, biophysical, and computational methods:

  • Substrate analog studies: Synthesize and test a series of 4-amino-4-deoxy-L-arabinose (Ara4N) lipid derivatives with systematic structural variations to identify essential recognition elements. Research has shown that the configuration of double bonds near the anomeric phosphate moiety can be critical for substrate recognition in related systems. For example, in studies of ArnT, only the α-neryl derivative (with a Z-configured double bond) was accepted as a substrate . This suggests that specific stereochemical features are likely important for ArnF recognition as well.

  • Mutational analysis guided by structural predictions:

    • Identify conserved residues in predicted substrate-binding regions

    • Generate point mutations and assess their effects on substrate binding and translocation

    • Create chimeric proteins with related flippases to delineate specificity-determining regions

  • Computational modeling and simulation:

    • Perform molecular docking of Ara4N-lipid substrates to predicted binding sites

    • Conduct molecular dynamics simulations to understand substrate-protein interactions

    • Use quantum mechanical calculations to examine critical electronic interactions

  • Biophysical binding studies:

    • Isothermal titration calorimetry to measure binding affinities for different substrates

    • Surface plasmon resonance to determine kinetic parameters of substrate binding

    • Fluorescence-based binding assays with labeled substrate analogs

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM with substrate or substrate analogs

    • NMR studies of substrate-binding domains

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes upon substrate binding

These approaches can reveal the molecular basis for ArnF's ability to recognize and translocate specific lipid-linked Ara4N intermediates, which is essential for understanding how bacteria modulate their surface characteristics to achieve antimicrobial resistance. The findings could potentially guide the design of inhibitors that disrupt this process, thereby sensitizing resistant bacteria to conventional antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.