Recombinant Escherichia coli O6:K15:H31 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

yciB and its partner protein, DcrB, are essential for maintaining cell envelope homeostasis. Key findings from functional studies include:

Synergistic Role in Cell Envelope Integrity

  • Membrane Stability: Deletion of both yciB and dcrB leads to pleiotropic defects, including:

    • Membrane Vesiculation: Dynamic shrinking/extending of the inner membrane .

    • Lysis: Increased cell death due to compromised membrane-peptidoglycan linkages .

  • Protein Targeting:

    • Lpp Stalling: The outer membrane lipoprotein Lpp accumulates at the periplasmic face of the inner membrane, causing lethal linkages .

    • Skp Chaperone Interaction: Skp may mistarget porins into the inner membrane, exacerbating cell death .

Stress Response Regulation

  • Cpx Pathway Activation: The Cpx signal transduction system is induced in yciB dcrB mutants, suggesting envelope stress .

Recombinant Expression

yciB is produced via heterologous expression in E. coli, often using T7 promoter systems (e.g., BL21(DE3) strains) . Challenges include:

  • Cytotoxicity: High-level expression may require strain optimization (e.g., C41/C43 strains with weaker T7 RNAP promoters) .

  • Disulfide Bond Formation: For membrane proteins, strains like Origami™ (trxB− gor−) or SHuffle® (trxB− gor− + DsbC) enhance proper folding .

ParameterOptimal Conditions
Expression StrainBL21(DE3), C41(DE3), SHuffle® T7 Express
InductionIPTG (isopropyl β-D-1-thiogalactopyranoside)
SolubilityOften insoluble; requires solubility enhancers (e.g., fusion tags)

Key Phenotypic Observations

ObservationMechanistic Insight
Membrane VesiculationCompromised membrane-peptidoglycan linkages → structural instability .
Lpp StallingImpaired outer membrane biogenesis → accumulation of mislocalized proteins .
Cpx Pathway ActivationEnvelope stress triggers Cpx, critical for survival in mutants .

Interplay with Skp Chaperone

  • Porin Mistargeting: Skp may redirect porins (e.g., OmpF) into the inner membrane, disrupting outer membrane integrity .

Implications for Pathogenicity and Future Research

  • UPEC Pathogenesis: yciB’s role in maintaining membrane stability is vital for UPEC survival in host environments .

  • Antibiotic Targets: Disruption of yciB/DcrB interactions may offer novel therapeutic avenues against ExPEC infections.

  • Structural Studies: High-resolution crystallography or cryo-EM could elucidate yciB’s binding interface with DcrB and membrane components.

References

  1. Recombinant yciB Product Specifications .

  2. Functional Synergy with DcrB .

  3. Recombinant Protein Expression Strategies .

  4. Genomic Context in UPEC Strain 536 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; ECP_1302; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: ecp:ECP_1302

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of YciB and how can it be experimentally determined?

YciB is a multi-pass inner membrane protein containing five transmembrane domains. The membrane topology can be experimentally determined using a dual pho-lac reporter system. In this methodology, researchers can use the pKTop plasmid in E. coli strain DH5α (*phoA- lacZ-*ΔM15) to determine whether the C-terminus of YciB resides in the cytoplasm or periplasm . This approach relies on color indicators that reveal the cellular localization of protein segments.

The topology mapping results confirm that YciB contains five transmembrane domains as predicted by bioinformatic analyses. When designing experiments to study YciB membrane topology, it is important to consider:

  • Strategic placement of reporter fusions at predicted loop regions

  • Controls to validate membrane integration

  • Confirmation of results with complementary techniques such as cysteine accessibility methods

What protein interactions does YciB form and how can they be detected?

YciB has been found to interact with various proteins involved in cell elongation and cell division. These interactions can be detected using several methodological approaches:

Bacterial Two-Hybrid System:
This has been the primary method used to identify YciB interaction partners, revealing associations with proteins involved in cell elongation and division complexes .

Direct Protein Interaction Assays:
Purified YciB protein has been shown to directly interact with ZipA, an essential cell division protein .

Protein Interaction Network:

YciB Interacting ProteinComplex/FunctionDetection MethodReference
ZipADivisomeDirect interaction with purified protein
FtsIDivisomeBacterial two-hybrid
FtsQDivisomeBacterial two-hybrid
RodZElongasomeBacterial two-hybrid
RodAElongasomeBacterial two-hybrid

When designing interaction studies, researchers should consider using multiple complementary approaches to validate findings and minimize false positives.

What phenotypes are observed in YciB mutants and how can they be characterized?

YciB deletion and overexpression mutants exhibit distinct phenotypes that provide insights into its cellular function:

Deletion Mutant (ΔyciB) Phenotypes:

  • Shorter cell length compared to wild type

  • Increased susceptibility to low osmolarity conditions

  • Disrupted septum localization of ZipA

  • Conditional lethality when combined with dcrB deletion

Overexpression Phenotypes:

  • Elongation of cells

Methodological Approaches for Phenotypic Characterization:

  • Microscopy techniques:

    • Phase contrast for general morphology

    • Fluorescence microscopy with membrane stains (e.g., SynaptoRed C2/FM4-64) to visualize septum formation

    • Immunolabeling with protein-specific antibodies (e.g., for FtsZ)

  • Growth assays:

    • Testing growth under varying osmolarity conditions

    • Temperature sensitivity tests (as seen in the related YhcB/ZapG protein)

  • Cell wall synthesis analysis:

    • Using fluorescent D-amino acid analogs (e.g., NADA, EDA-DA) to monitor peptidoglycan synthesis

How does YciB contribute to biofilm formation in E. coli?

Recent studies have identified YciB as a gene required for normal biofilm formation in E. coli . While the precise mechanism remains under investigation, its role appears to be linked to cell envelope synthesis and interactions with proteins involved in maintaining cell morphology.

Experimental Approaches for Studying YciB in Biofilm Formation:

  • Genetic analyses:

    • Comparison of wild-type and ΔyciB mutant biofilm formation using crystal violet assays

    • Complementation studies to confirm phenotype specificity

  • Microscopic evaluation:

    • Confocal microscopy to assess biofilm architecture

    • Live/dead staining to evaluate cell viability within biofilms

  • Expression studies:

    • RT-qPCR analysis of biofilm-related genes in ΔyciB mutants

    • Transcriptomic analysis to identify affected pathways

What is the molecular mechanism by which YciB influences cell division and envelope synthesis?

YciB appears to function at the intersection of cell division and cell envelope synthesis through its interactions with both divisome and elongasome components. Current evidence suggests several possible mechanisms:

  • Coordinating divisome assembly: YciB interacts with ZipA, which is essential for proper Z-ring formation. In ΔyciB mutants, ZipA localization at the septum is disturbed, suggesting YciB may help position or stabilize ZipA .

  • Linking cell division and cell wall synthesis: The interaction with both divisome (FtsI, FtsQ) and elongasome (RodZ, RodA) components suggests YciB may coordinate these processes .

  • Maintaining envelope integrity: The genetic interaction with rodZ, which is important for rod-type morphology, indicates YciB contributes to proper envelope synthesis during growth and division .

Experimental Design Considerations:

  • Site-directed mutagenesis: To identify critical residues for YciB function and protein interactions

  • Domain swap experiments: To determine which regions of YciB are responsible for specific protein interactions

  • Super-resolution microscopy: To map the precise localization of YciB relative to divisome and elongasome components during the cell cycle

  • In vitro reconstitution experiments: To test direct effects of YciB on cell division and envelope synthesis machinery

How does the genetic interaction between YciB and DcrB affect lipoprotein maturation?

The synthetic lethality between yciB and dcrB provides insights into the role of YciB in lipoprotein processing and cell envelope integrity. The conditional lethality arises from defects in lipoprotein maturation, specifically:

  • Reduced Lgt-catalyzed diacylglycerol (DAG) transfer: The YciB/DcrB double mutant shows inefficiency in the first step of lipoprotein maturation .

  • Mislocalization of outer membrane lipoproteins: Several lipoproteins, including the abundant Lpp, are mislocalized to the inner membrane in the double mutant .

  • Toxic inner membrane-peptidoglycan associations: Mislocalized Lpp mediates toxic connections between the inner membrane and peptidoglycan .

Experimental Data on Stress Response Activation:

Stress ResponseyciB MutantdcrB MutantyciB dcrB Double MutantyciB dcrB + Lgt Overexpression
Rcs ActivationMinimalMinimal>10-fold increaseNear wild-type levels
Cpx Activation3-fold increaseMinimal5-fold increasePartially reduced (~1/3)

Methodological Approaches:

  • Membrane fractionation: To track lipoprotein localization

  • Reporter gene assays: To monitor stress response pathway activation

  • Suppressor screens: To identify genes that can alleviate the synthetic lethality

  • Lipidomic analysis: To characterize alterations in membrane lipid composition that may affect lipoprotein processing

What experimental approaches can resolve inconsistencies in YciB functional characterization?

Several inconsistencies exist in the literature regarding YciB function, particularly in relation to its nomenclature (YciB vs. YhcB/ZapG) and precise cellular role. Resolving these requires systematic experimental approaches:

  • Standardized strain backgrounds: Many phenotypic differences may result from strain-specific genetic contexts.

  • Comprehensive protein interaction mapping: Using multiple complementary techniques:

    • Two-hybrid systems (bacterial and yeast)

    • Pull-down assays with purified components

    • Cross-linking mass spectrometry

    • BioID or APEX proximity labeling

  • Cross-species functional conservation analysis:

    • Testing if YciB orthologs from different bacteria can complement E. coli ΔyciB

    • Comparing interaction networks across species

  • Integrated multi-omics approach:

    • Transcriptomics of ΔyciB under various conditions

    • Quantitative proteomics to identify altered protein levels

    • Metabolomics to detect changes in cell wall precursors

    • Lipidomics to assess membrane composition changes

How can advanced imaging techniques enhance our understanding of YciB localization and dynamics?

To better understand YciB's role in cell division and envelope synthesis, researchers can employ sophisticated imaging approaches:

  • Super-resolution microscopy techniques:

    • Structured illumination microscopy (SIM)

    • Photoactivated localization microscopy (PALM)

    • Stochastic optical reconstruction microscopy (STORM)

  • Live-cell imaging with fluorescent protein fusions:

    • Dual-color imaging with divisome markers

    • Time-lapse microscopy to track YciB during the cell cycle

  • Correlative light and electron microscopy (CLEM):

    • To connect YciB localization with ultrastructural features

  • Single-molecule tracking:

    • To measure YciB diffusion dynamics in the membrane

    • To detect transient interactions with division proteins

Experimental Design Considerations:

  • Ensure fluorescent tags do not disrupt YciB function

  • Include appropriate controls for photobleaching and phototoxicity

  • Use deconvolution algorithms to enhance image resolution

  • Quantify protein localization patterns with specialized software

What strategies can overcome challenges in structural studies of YciB?

As a membrane protein with five transmembrane domains, YciB presents challenges for structural characterization. Researchers can consider the following methodological approaches:

  • X-ray crystallography of soluble domains:

    • The cytosolic domain of related proteins (e.g., YhcB/ZapG) has been successfully crystallized at 2.8 Å resolution, revealing a tetrameric α-helical coiled-coil structure .

  • Cryo-electron microscopy:

    • Single-particle analysis of detergent-solubilized or nanodisc-reconstituted YciB

    • Subtomogram averaging of membrane-embedded YciB

  • NMR spectroscopy:

    • Solution NMR of isolated soluble domains

    • Solid-state NMR for membrane-embedded regions

  • Integrative structural biology:

    • Combining low-resolution techniques (SAXS, SANS) with computational modeling

    • Cross-linking mass spectrometry to identify proximity constraints

    • Evolutionary coupling analysis to predict residue contacts

How should researchers design genetic screens to identify new YciB interaction partners?

Systematic genetic approaches can uncover novel YciB functions and interactions:

  • Synthetic genetic arrays:

    • Cross a ΔyciB mutant with a genome-wide deletion library

    • Identify synthetic lethal or synthetic sick interactions

  • Suppressor screens:

    • Isolate suppressors of ΔyciB phenotypes (e.g., osmotic sensitivity)

    • Whole-genome sequencing to identify suppressor mutations

  • Conditional depletion strategies:

    • For essential interaction partners

    • Use degradation tags or repressible promoters

  • Chemical genetic approaches:

    • Screen for compounds that specifically affect ΔyciB mutants

    • Identify pathways linked to YciB function

Case Study: Synthetic Interactions
Previous studies have identified synthetic lethal or fitness interactions between yhcB (related to yciB) and genes involved in cell division (ftsI, ftsQ), cell wall biosynthesis (mrdA), and cell shape maintenance (mreB) . Similar approaches can be applied specifically to yciB.

What experimental design principles are optimal for studying YciB function in stress conditions?

When investigating YciB's role during stress conditions, consider these methodological principles:

  • Control variable selection:

    • Carefully select stress variables (osmolarity, temperature, pH, antibiotics)

    • Use dose-response approaches to identify threshold effects

  • Time-course experiments:

    • Acute vs. chronic stress exposures may reveal different roles

    • Monitor adaptation processes over time

  • Multi-factorial design:

    • Test interactions between different stressors

    • Use statistical methods like Design of Experiments (DoE) to optimize experimental efficiency

  • Rigorous statistical analysis:

    • Use appropriate statistical tests for different experimental designs

    • Consider using the Montgomery approach for analysis of experiments

Example Experimental Design for Osmotic Stress Response:

FactorLow LevelMid LevelHigh Level
NaCl Concentration0 mM250 mM500 mM
Temperature30°C37°C42°C
Growth PhaseEarly logMid logStationary

Using a factorial design would allow researchers to identify interactions between these variables and determine conditions where YciB function is most critical.

How can contradictory data about YciB function be reconciled through improved experimental design?

To address contradictions in the literature regarding YciB function:

  • Standardize experimental conditions:

    • Use identical growth media, temperature, and strains across experiments

    • Clearly report all experimental parameters

  • Implement robust controls:

    • Include both positive and negative controls

    • Use complementation tests to confirm phenotype specificity

  • Employ orthogonal methods:

    • Verify findings using multiple independent techniques

    • Cross-validate protein interactions with different assays

  • Conduct power analyses:

    • Ensure sufficient statistical power to detect effects

    • Report effect sizes alongside p-values

  • Pre-register experimental designs:

    • Clearly define hypotheses and analysis plans before conducting experiments

    • Minimize post-hoc interpretations

How might targeted mutagenesis approaches advance our understanding of YciB function?

Systematic mutagenesis strategies can provide insights into structure-function relationships:

  • Alanine-scanning mutagenesis:

    • Replace conserved residues with alanine

    • Test effects on protein interactions and phenotypes

  • Domain deletion analysis:

    • Create truncated versions of YciB

    • Determine minimal functional domains

  • Cross-species chimeras:

    • Swap domains between YciB orthologs

    • Identify species-specific functional elements

  • Site-directed mutagenesis:

    • Target residues predicted to be involved in protein-protein interactions

    • Modify potential membrane-interacting residues

Potential Targets for Mutagenesis:
Based on interaction data with ZipA and cell division proteins, researchers should focus on cytoplasmic domains that are likely involved in protein-protein interactions . Additionally, targeting transmembrane regions may reveal how YciB senses membrane properties or stress conditions.

What computational approaches can complement experimental studies of YciB?

Computational methods can provide valuable insights and guide experimental design:

  • Molecular dynamics simulations:

    • Model YciB in membrane environments

    • Predict conformational changes during interactions

  • Protein-protein docking:

    • Predict interaction interfaces with divisome and elongasome components

    • Guide mutagenesis experiments

  • Evolutionary analysis:

    • Identify conserved residues across bacterial species

    • Detect co-evolving residue pairs indicating functional interactions

  • Network analysis:

    • Map YciB within the broader cell division interactome

    • Identify potential functional modules

  • Machine learning approaches:

    • Predict additional interaction partners

    • Identify patterns in phenotypic data

By integrating computational predictions with experimental validation, researchers can develop more focused hypotheses about YciB function and accelerate discovery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.