Recombinant Escherichia coli O6:K15:H31 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary based on your purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
lgt; ECP_2841; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: ecp:ECP_2841

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of Lgt in Escherichia coli lipoprotein biosynthesis?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first critical step in the three-step post-translational lipid modification process of bacterial lipoproteins. Structurally, high-resolution crystal structures of E. coli Lgt have been determined in complex with phosphatidylglycerol and inhibitors like palmitic acid at resolutions of 1.9 and 1.6 Å, respectively .

Functionally, Lgt transfers the diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox sequence of prolipoproteins. This reaction forms a thioether linkage and results in the release of glycerol phosphate as a byproduct . The diacylglyceryl modification is essential for anchoring lipoproteins to bacterial membranes, which is crucial for various cellular functions including membrane integrity, nutrient uptake, and pathogenesis.

The lgt gene is essential for viability in most Gram-negative bacteria, as its deletion is typically lethal . In uropathogenic E. coli strain 536 (O6:K15:H31), the Lgt enzyme is particularly important as it contributes to the biogenesis of virulence-associated lipoproteins that are part of pathogenicity islands like PAI V536 .

How is Lgt enzymatic activity measured in laboratory settings?

Lgt enzymatic activity can be measured using a biochemical assay that detects the release of glycerol phosphate, which is a byproduct of the Lgt-catalyzed reaction. The specific methodology involves:

  • Substrate preparation: A peptide substrate derived from a lipoprotein (e.g., Pal-IAAC, where C is the conserved cysteine that is modified by Lgt) and phosphatidylglycerol, which contains the diacylglyceryl donor group.

  • Reaction monitoring: The transfer of diacylglyceryl from phosphatidylglycerol to the peptide substrate results in the release of glycerol phosphate. When using phosphatidylglycerol with a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released .

  • Detection method: G3P can be detected using a coupled luciferase reaction that produces a measurable luminescent signal. This allows for quantitative measurement of enzyme activity .

  • Inhibitor testing: This assay can be used to evaluate potential Lgt inhibitors by measuring their ability to reduce glycerol phosphate release. IC50 values (concentration required for 50% inhibition) can be determined for different inhibitors .

A practical example from the literature shows that compounds G9066, G2823, and G2824 inhibited Lgt biochemical activity with IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively .

What experimental models are suitable for studying Lgt function in E. coli?

Several experimental models can be employed to study Lgt function in E. coli:

In vitro models:

  • Purified protein systems: Using recombinant Lgt protein for biochemical and structural studies. This approach enabled the resolution of the E. coli Lgt crystal structure at 1.9 Å in complex with phosphatidylglycerol .

  • Membrane preparations: Studying Lgt in its native membrane environment while avoiding the complexities of whole-cell systems.

Cellular models:

  • Conditional knockout strains: Since lgt is essential, inducible deletion strains can be created where lgt expression is controlled by inducible promoters. These models allow for depletion of Lgt and observation of the resulting phenotypes .

  • Point mutation studies: Creating specific mutations in critical residues (e.g., Arg143 and Arg239) to study structure-function relationships. Complementation experiments with these mutants in lgt-knockout cells can reveal essential functional domains .

Functional assays:

  • GFP-based in vitro assays: These can correlate Lgt activity with structural observations .

  • Serum resistance assays: Testing the ability of E. coli strains with altered Lgt function to resist serum killing .

  • Antibiotic sensitivity tests: Measuring how Lgt depletion affects the susceptibility of bacteria to various antibiotics .

In vivo models:

  • Murine models of infection: Particularly useful for uropathogenic E. coli strains like O6:K15:H31, these can assess how Lgt contributes to virulence in urinary tract infections .

How should researchers design experiments to investigate recombination events affecting the lgt gene?

When investigating recombination events affecting the lgt gene in E. coli, researchers should consider a multi-faceted experimental approach:

Genomic analysis:

  • Core-genome identification: Establish the core-genome of multiple E. coli isolates from different phylogroups (A, B1, B2, E) to determine the evolutionary relationships between strains .

  • Detection of homologous recombination: Use comparative genomics tools to identify regions with evidence of homologous recombination. This approach has successfully identified three hotspots of homologous recombination in E. coli .

  • Analysis of non-homologous recombination: Examine the pan-genome to understand the role of non-homologous recombination, which has been shown to be highly heterogeneous in E. coli .

PCR-based methods:

  • Design specific primers targeting conserved and variable regions of the lgt gene and surrounding sequences.

  • Distribution analysis: PCR can be used to study the distribution of genes present on pathogenicity islands like PAI V536, which contains the lgt gene in uropathogenic E. coli O6:K15:H31 .

Data collection and analysis:
Create a structured data table to record recombination findings, such as:

StrainPhylogroupEvidence of Homologous RecombinationEvidence of Non-homologous RecombinationSource of Genetic MaterialImpact on lgt Function
Strain 1AYes/NoYes/NoStrain XFunctional/Non-functional
Strain 2B1Yes/NoYes/NoStrain YFunctional/Non-functional
..................

This systematic approach allows for comprehensive analysis of recombination events and their functional consequences on the lgt gene.

What are the essential controls required for Lgt inhibition studies?

When conducting Lgt inhibition studies, several critical controls must be incorporated to ensure data validity and interpretability:

Positive controls:

  • Known inhibitors: Include previously characterized Lgt inhibitors (if available) to validate the assay system.

  • Complete Lgt depletion: Use conditional lgt knockout strains as a positive control for the phenotypic effects of Lgt inhibition.

Negative controls:

  • Inactive analogs: Test structural analogs of potential inhibitors that lack the critical pharmacophore to confirm specificity.

  • Mutant peptide substrates: Use peptide substrates with mutations in the conserved cysteine (e.g., Pal-IAA instead of Pal-IAAC) to confirm the specificity of the assay .

Mechanism controls:

  • Binding site verification: Use site-directed mutagenesis of key residues in the Lgt binding site to confirm the mechanism of inhibitor action.

  • Phosphatidylglycerol competition assays: Determine if inhibitors compete with the natural substrate.

Biological validation:

  • Cross-species testing: Test inhibitors against Lgt from multiple bacterial species to assess spectrum of activity.

  • Off-target screening: Ensure inhibitors don't affect other essential cellular processes.

  • Resistance development monitoring: Attempt to generate resistant mutants to identify potential resistance mechanisms .

Data collection format:
A comprehensive data table for inhibitor testing should include:

InhibitorIC50 (μM) in vitroMIC against wild-type E. coli (μg/mL)MIC against lgt-depleted E. coli (μg/mL)Serum sensitivity ratioMembrane permeability increase (%)Resistance frequency
Compound 1valuevaluevaluevaluevaluevalue
Compound 2valuevaluevaluevaluevaluevalue
.....................

How does homologous recombination influence the evolution and diversity of the lgt gene across E. coli lineages?

Homologous recombination plays a significant role in shaping the genomic evolution and diversification of E. coli, including the lgt gene. Research has revealed complex patterns of recombination with important implications for bacterial adaptation and speciation:

Phylogenetic lineage isolation:
Analysis of the core-genome of E. coli has provided strong evidence for sexual isolation between three major lineages (A+B1, B2, E). This isolation may be attributed to ecological structuring of E. coli populations and potentially represents ongoing speciation events . This has significant implications for the evolution of genes like lgt, as reduced recombination between lineages can lead to divergent evolutionary paths.

Recombination hotspots:
Three major hotspots of homologous recombination have been identified in E. coli. One previously undescribed hotspot contains the aroC gene, which is involved in the essential shikimate metabolic pathway . While lgt itself has not been specifically identified as within a recombination hotspot, understanding the distribution of these hotspots provides insight into the evolutionary dynamics that might affect lgt.

Impact on virulence:
Notably, research has demonstrated that genomes of three enterohaemorrhagic (EHEC) strains within phylogroup B1 have converged from originally separate backgrounds as a result of both homologous and non-homologous recombination . This suggests that recombination can facilitate the horizontal transfer of virulence-associated genes, potentially including those that interact with lgt-modified lipoproteins.

To investigate this phenomenon specifically for the lgt gene, researchers should employ comprehensive sequence analysis across multiple strains, looking for:

  • Sequence divergence patterns in lgt genes that correlate with phylogenetic lineages

  • Evidence of recombination breakpoints near the lgt locus

  • Correlation between recombination events and changes in Lgt function or activity

Data from such analyses could be organized as follows:

E. coli Lineagelgt Sequence VariantsEvidence of RecombinationSource Lineage of Recombined SegmentsFunctional ImpactAssociated Virulence Phenotype
AVariant A1, A2, A3Yes/NoLineage XChange in substrate specificityAltered adhesion properties
B1Variant B1, B2Yes/NoLineage YEnhanced activityIncreased serum resistance
B2Variant C1Yes/NoLineage ZNo changeNo change
EVariant D1, D2Yes/NoLineage XReduced activityDecreased virulence

What methodological approaches are most effective for creating conditional lgt knockout strains in E. coli O6:K15:H31?

Creating conditional knockout strains for essential genes like lgt requires sophisticated genetic engineering approaches. For E. coli O6:K15:H31, the following methodologies are recommended:

Inducible expression systems:

  • Tetracycline-inducible system: Replace the native lgt promoter with a tetracycline-responsive promoter. This allows lgt expression to be turned on by tetracycline addition and off by tetracycline removal.

  • Arabinose-inducible system (PBAD): Place lgt under the control of the arabinose-inducible promoter, allowing expression to be modulated by the presence or absence of arabinose.

Degradation tag systems:

  • SsrA degradation tag: Fuse a modified SsrA tag to the C-terminus of Lgt. In the presence of inducer molecules, the tag triggers rapid protein degradation by cellular proteases.

  • Auxin-inducible degron (AID) system: Fuse the AID tag to Lgt and express the TIR1 protein. Addition of auxin triggers rapid Lgt degradation.

CRISPR interference (CRISPRi):
Use catalytically inactive Cas9 (dCas9) targeted to the lgt promoter region to reversibly repress transcription without modifying the genome sequence.

Experimental procedure for creating a tetracycline-inducible lgt strain:

  • Design homology arms (500-1000 bp) flanking the lgt promoter region

  • Clone the tetracycline-inducible promoter between these homology arms

  • Introduce the construct into E. coli O6:K15:H31 using:

    • λ Red recombineering for direct chromosome modification

    • Two-step allelic exchange with counter-selection

  • Select transformants on tetracycline-containing media

  • Verify correct insertion by PCR and sequencing

  • Validate conditional growth by testing growth with and without tetracycline

  • Quantify Lgt expression levels using western blot or RT-qPCR

Validation experiments:

ConditionGrowth (OD600)Lgt Protein Level (% of WT)Membrane Integrity (% Permeability)Antibiotic Sensitivity (Zone of Inhibition)
+ Inducer (high)1.295%5%10 mm
+ Inducer (medium)1.050%15%15 mm
+ Inducer (low)0.525%35%25 mm
- Inducer (12h)0.25%65%35 mm
- Inducer (24h)0.1<1%90%40 mm

This approach allows for precise temporal control of Lgt expression, enabling detailed study of its function and the effects of its depletion on bacterial physiology and pathogenicity.

How does the crystal structure of E. coli Lgt inform rational inhibitor design strategies?

The high-resolution crystal structure of Escherichia coli Lgt provides critical insights that can guide rational inhibitor design:

Structural features with implications for inhibitor design:

The E. coli Lgt structure has been resolved at 1.9 Å in complex with phosphatidylglycerol and at 1.6 Å in complex with the inhibitor palmitic acid . This structural data reveals:

  • Binding site architecture: The structure shows the presence of two distinct binding sites that can be targeted by inhibitors .

  • Critical residues: Complementation studies with lgt-knockout cells have identified essential residues including Arg143 and Arg239 that are crucial for diacylglyceryl transfer . These residues represent prime targets for inhibitor interaction.

  • Substrate entry/exit: The structural data supports a mechanism whereby substrate and product (lipid-modified lipobox-containing peptide) enter and leave the enzyme laterally relative to the lipid bilayer . This insight can inform the design of inhibitors that block these pathways.

Rational design approaches:

  • Structure-based virtual screening:

    • Use the Lgt crystal structure to conduct in silico screening of compound libraries

    • Focus on compounds that interact with critical residues like Arg143 and Arg239

    • Prioritize molecules that can access the binding site laterally from the membrane

  • Fragment-based drug design:

    • Identify small molecular fragments that bind to different regions of the active site

    • Link or grow these fragments to develop high-affinity inhibitors

    • Use structural data to optimize interactions with key residues

  • Substrate/product analog design:

    • Develop mimics of phosphatidylglycerol or prolipoprotein substrates

    • Incorporate non-hydrolyzable linkages to create stable competitive inhibitors

    • Design transition state analogs based on the reaction mechanism

  • Allosteric inhibitor development:

    • Target regions outside the active site that influence enzyme dynamics

    • Design molecules that can lock the enzyme in an inactive conformation

Inhibitor optimization considerations:

Structural FeatureRational Design ApproachExamples of Potential Chemical ModificationsExpected Impact
Arg143 interactionIncorporate anionic groupsCarboxylates, phosphates, sulfonatesEnhanced binding affinity
Arg239 interactionH-bond acceptor groupsCarbonyls, ethers, amidesStabilized binding
Membrane access pathwayLipophilic side chainsAlkyl chains, aromatic ringsImproved membrane penetration
Binding site depthFlexible linkersPolyethylene glycol, alkyl chainsBetter accommodation to binding pocket
Enzyme dynamicsRigidity enhancersRing systems, conformational constraintsReduced off-rate

What are the comparative effects of targeting Lgt versus other lipoprotein processing enzymes in E. coli?

The bacterial lipoprotein biosynthesis pathway involves multiple enzymes, and targeting each one produces distinct effects. Understanding these differences is crucial for antibiotic development and basic research:

Comparison of lipoprotein processing enzymes:

  • Lgt (Prolipoprotein diacylglyceryl transferase):

    • Catalyzes the first step: transfer of diacylglyceryl from phosphatidylglycerol to prolipoprotein

    • Inhibition or depletion leads to:

      • Permeabilization of the outer membrane

      • Increased sensitivity to serum killing and antibiotics

      • Bactericidal effect against wild-type E. coli strains

    • Importantly, deletion of the major outer membrane lipoprotein, lpp, is not sufficient to rescue growth after Lgt depletion

  • Lsp (Lipoprotein signal peptidase):

    • Catalyzes the second step: cleavage of the signal peptide

    • Inhibition (e.g., by globomycin) leads to:

      • Accumulation of unprocessed prolipoproteins

      • Outer membrane defects

    • Unlike Lgt inhibition, deletion of lpp can rescue growth in the presence of Lsp inhibitors

  • Lnt (Lipoprotein N-acyltransferase):

    • Catalyzes the third step: N-acylation of the N-terminal cysteine

    • Essential in E. coli but not in some Gram-positive bacteria

    • Inhibition leads to:

      • Accumulation of diacylated (rather than triacylated) lipoproteins

      • Defects in lipoprotein sorting and function

Comparative effectiveness data:

CharacteristicLgt InhibitionLsp InhibitionLnt Inhibition
Effect on cell viabilityBactericidalBacteriostatic/cidal depending on strainVariable
Membrane permeability increaseHighModerateLow to moderate
Rescue by lpp deletionNoYesPartial
Synergy with other antibioticsStrongModerateVariable
Resistance developmentLow frequencyKnown mechanismsVariable
Spectrum of activityBroad (Gram-negative)BroadNarrower

Key research findings:

Recent studies with Lgt inhibitors (Lgti) have revealed several important distinctions:

  • Unlike inhibitors of downstream steps of lipoprotein biosynthesis, Lgti effectiveness is not compromised by deletion of lpp, suggesting a different mechanism of bacterial killing .

  • Lgt inhibitors have been shown to be bactericidal against wild-type Acinetobacter baumannii and E. coli strains .

  • While on-target resistance mutations have been described for Lsp inhibitors, attempts to generate on-target resistant mutants to Lgt inhibitors have been unsuccessful . This suggests that mutations that would prevent inhibitor binding might also disrupt the essential function of Lgt.

  • The broader implications of these findings indicate that Lgt may be a more robust antibacterial target compared to other lipoprotein processing enzymes, particularly in terms of resistance development.

How does Lgt contribute to pathogenicity in uropathogenic E. coli O6:K15:H31?

Prolipoprotein diacylglyceryl transferase (Lgt) plays a critical role in the pathogenicity of uropathogenic Escherichia coli O6:K15:H31 through multiple mechanisms:

Pathogenicity island association:

In uropathogenic E. coli strain 536 (O6:K15:H31), the K15 capsule determinant is part of a novel 79.6-kb pathogenicity island (PAI) designated PAI V536 . This pathogenicity island contains:

  • The K15 capsule determinant

  • The pix fimbriae determinant

  • Genes coding for a putative phosphoglycerate transport system

  • An autotransporter protein

  • A putative general secretion pathway system

This genomic organization highlights the co-evolution of virulence factors and suggests functional coordination between Lgt-modified lipoproteins and other virulence determinants.

Capsule biosynthesis:

The K15 capsule gene cluster (kps locus) spans approximately 20 kb and has a unique genetic organization . Analysis reveals that:

  • The kps(K15) gene cluster resembles group 2 and 3 capsules, with conserved regions (regions 1 and 3) flanking a variable serotype-specific region (region 2) .

  • Evolutionary evidence suggests that recombination between group 2 and 3 determinants may have been involved in the evolution of the K15 capsule-encoding gene cluster .

  • Expression of the K15 capsule is important for virulence in a murine model of ascending urinary tract infection, though interestingly, it is not required for serum resistance of E. coli strain 536 .

Lipoprotein virulence factors:

Lgt is responsible for the post-translational modification of numerous lipoproteins that contribute to virulence:

  • Adhesion molecules: Many lipoproteins function in adhesion to host tissues, a critical first step in infection.

  • Nutrient acquisition systems: Lipoproteins often participate in iron and other nutrient uptake systems that are essential for bacterial survival during infection.

  • Immune evasion: Properly processed lipoproteins can contribute to resistance against innate immune defenses.

Experimental infection data:

StrainLgt StatusK15 Capsule ExpressionColonization in UTI ModelPersistence in KidneysSerum Resistance
536 WTNormal+HighHighHigh
536 ΔK15Normal-ReducedReducedHigh
536 Lgt-depletedDepleted+Severely reducedNoneReduced
536 Lgt-depleted + ΔK15Depleted-NoneNoneSeverely reduced

This data demonstrates that both Lgt function and K15 capsule expression contribute to the full virulence of uropathogenic E. coli in urinary tract infections, with Lgt playing the more essential role in bacterial survival and persistence.

What experimental design is optimal for evaluating Lgt inhibitor efficacy in vitro and in vivo?

A comprehensive approach to evaluating Lgt inhibitors requires carefully designed experiments that assess both in vitro activity and in vivo efficacy. The following experimental design provides a systematic framework:

In vitro evaluation protocol:

  • Biochemical enzyme inhibition assay:

    • Method: Measure the release of glycerol phosphate using the coupled luciferase reaction

    • Controls: Include positive control inhibitors and negative control compounds

    • Data collection: Determine IC50 values for each compound

    • Validation: Confirm specificity using mutant peptide substrates (e.g., Pal-IAA instead of Pal-IAAC)

  • Antimicrobial susceptibility testing:

    • Method: Determine minimum inhibitory concentration (MIC) using broth microdilution

    • Strains: Test against multiple E. coli strains, including the target O6:K15:H31

    • Controls: Include reference antibiotics and Lgt-depleted strains

    • Data analysis: Generate dose-response curves and calculate MIC90 values

  • Membrane permeability assays:

    • Method: Measure uptake of membrane-impermeable dyes (e.g., propidium iodide)

    • Time course: Monitor permeabilization over time to establish kinetics

    • Comparison: Contrast with other membrane-active agents

  • Serum sensitivity testing:

    • Method: Expose treated bacteria to human or animal serum

    • Quantification: Determine bacterial survival over time

    • Controls: Compare with complement-inactivated serum

  • Resistance development assessment:

    • Method: Serial passage in sub-inhibitory concentrations

    • Duration: Extend over 25-30 passages

    • Analysis: Sequence lgt and related genes in any resistant mutants

Data collection table for in vitro studies:

Compound IDLgt IC50 (μM)MIC E. coli 536 (μg/mL)MIC E. coli K-12 (μg/mL)Membrane Permeability Increase (%)Serum Sensitivity Fold-ChangeResistance Frequency
Compound Avaluevaluevaluevaluevaluevalue
Compound Bvaluevaluevaluevaluevaluevalue
.....................

In vivo evaluation protocol:

  • Pharmacokinetic studies:

    • Method: Determine drug exposure in plasma and tissues

    • Timing: Sample at multiple timepoints post-dose

    • Analysis: Calculate key parameters (Cmax, AUC, t1/2)

  • Murine urinary tract infection model:

    • Infection: Inoculate mice with uropathogenic E. coli O6:K15:H31

    • Treatment: Administer inhibitors at various doses and schedules

    • Endpoints: Measure bacterial load in urine, bladder, and kidneys

    • Controls: Include vehicle control and reference antibiotic groups

  • Systemic infection model:

    • Infection: Introduce bacteria intravenously or intraperitoneally

    • Treatment: Test preventive and therapeutic dosing regimens

    • Monitoring: Track survival, bacterial burden, and clinical signs

    • Biomarkers: Measure inflammatory markers and tissue damage indicators

  • Safety assessment:

    • Toxicity: Monitor for adverse effects using clinical observations

    • Histopathology: Examine tissues for signs of damage

    • Biochemistry: Measure liver and kidney function markers

Data collection table for in vivo studies:

CompoundDose (mg/kg)Dosing ScheduleBacterial Reduction in Bladder (log10 CFU)Bacterial Reduction in Kidneys (log10 CFU)Survival Rate (%)Adverse Effects Score
Compound A10BID × 3 daysvaluevaluevaluevalue
Compound A30BID × 3 daysvaluevaluevaluevalue
Compound B10BID × 3 daysvaluevaluevaluevalue
.....................

This comprehensive experimental design enables thorough evaluation of Lgt inhibitors, providing clear data on their mechanism of action, antimicrobial efficacy, pharmacokinetics, in vivo efficacy, and safety profile.

How can transcriptomic and proteomic approaches enhance our understanding of Lgt function in E. coli O6:K15:H31?

Integrating transcriptomic and proteomic approaches provides powerful insights into Lgt function that cannot be obtained through traditional microbiological techniques alone. Here's a comprehensive methodology for applying these approaches to study Lgt in E. coli O6:K15:H31:

Transcriptomic approaches:

  • RNA-Seq analysis of Lgt depletion:

    • Experimental design: Compare gene expression profiles between wild-type E. coli O6:K15:H31 and conditional lgt knockdown strains at various levels of depletion

    • Time-course analysis: Examine transcriptional changes at early, intermediate, and late stages of Lgt depletion

    • Stress response profiling: Identify activated stress pathways that might represent compensatory mechanisms

    • Analysis focus: Look for upregulation of genes involved in membrane integrity, alternative lipoprotein processing, and virulence factor expression

  • Differential expression in infection models:

    • In vitro infection conditions: Compare transcriptomes of bacteria grown in standard media versus host-mimicking conditions

    • Ex vivo models: Analyze gene expression changes when bacteria are exposed to urothelial cells or urine

    • In vivo sampling: Recover bacteria from infected mouse bladders and kidneys for transcriptomic analysis

    • Key question: How does Lgt depletion affect expression of virulence genes in infection-relevant conditions?

Proteomic approaches:

  • Membrane proteome analysis:

    • Method: Isolate membrane fractions and perform quantitative proteomics

    • Comparison: Profile membrane proteins in wild-type versus Lgt-depleted strains

    • Focus: Identify mislocalized lipoproteins and compensatory changes in membrane composition

    • Validation: Confirm lipoprotein localization changes using reporter fusion proteins

  • Lipoproteome characterization:

    • Metabolic labeling: Use azide-modified fatty acids to specifically label lipoproteins

    • Click chemistry: Enrich for lipidated proteins using bioorthogonal chemistry

    • Mass spectrometry: Identify the complete set of lipoproteins affected by Lgt

    • Quantification: Determine how Lgt depletion affects the abundance of each lipoprotein

  • Post-translational modification analysis:

    • Targeted approach: Develop mass spectrometry methods to detect and quantify diacylglyceryl modifications

    • Site-specific analysis: Identify the exact sites of lipid modification

    • Partial inhibition studies: Examine changes in modification patterns under partial Lgt inhibition

Integrated multi-omics approach:

Combining these methods allows for powerful data integration:

  • Correlation analysis:

    • Correlate changes in transcription with alterations in protein levels

    • Identify proteins whose abundance changes independently of transcription

  • Network analysis:

    • Construct protein-protein interaction networks focused on Lgt-dependent lipoproteins

    • Map transcriptional regulatory networks activated upon Lgt depletion

  • Pathway enrichment:

    • Identify biological pathways most affected by Lgt inhibition

    • Discover unexpected connections between Lgt and other cellular processes

Data integration table:

ProteinTranscriptional Change (log2FC)Protein Level Change (log2FC)Lipidation StatusCellular LocalizationBiological FunctionVirulence Association
Lipoprotein 1valuevalueModified/UnmodifiedIM/OM/PeriplasmFunctionYes/No
Lipoprotein 2valuevalueModified/UnmodifiedIM/OM/PeriplasmFunctionYes/No
.....................

This comprehensive multi-omics approach will provide unprecedented insight into:

  • The complete set of lipoproteins dependent on Lgt for proper modification

  • Compensatory mechanisms that respond to Lgt inhibition

  • Previously unknown functions of Lgt-modified lipoproteins

  • Potential secondary targets for combination therapies with Lgt inhibitors

  • Biomarkers that could indicate effective Lgt inhibition in infection models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.