Recombinant Escherichia coli O6:K15:H31 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; ECP_0655; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links

KEGG: ecp:ECP_0655

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CrcB homolog in Escherichia coli O6:K15:H31 and what is its primary function?

CrcB homolog in Escherichia coli O6:K15:H31 (UniProt ID: Q0TK48) is a putative fluoride ion transporter comprising 127 amino acids. The protein functions primarily as a transmembrane channel that mediates fluoride ion efflux, providing resistance against fluoride toxicity in bacterial cells. CrcB proteins represent a conserved family of fluoride channels present across various bacterial species, with CrcB in E. coli sharing approximately 50% sequence similarity with other characterized bacterial CrcB proteins . The functional importance of CrcB has been demonstrated in studies with oral streptococci, where both crcB1 and crcB2 genes were found to be critical for fluoride resistance .

How does CrcB homolog compare to similar proteins in other bacterial species?

CrcB homolog from E. coli O6:K15:H31 shares significant structural and functional homology with CrcB proteins found in other bacterial species. Studies have shown that the CrcB from E. coli shares approximately 50% sequence similarity with CrcB from E. coli K-12, which has been extensively studied for its role in fluoride resistance . In oral streptococci, two types of crcB genes (crcB1 and crcB2) have been identified, both showing similar levels of sequence homology to E. coli CrcB .

The conservation of CrcB across diverse bacterial species underscores its fundamental importance in fluoride homeostasis. Comparative analysis of CrcB proteins from different species can provide insights into structural determinants of function and species-specific adaptations.

What expression systems are most effective for recombinant CrcB homolog production?

For optimal expression of recombinant CrcB homolog, E. coli-based expression systems have proven most effective, particularly for the production of the His-tagged variant. The commercially available recombinant full-length CrcB homolog (Q0TK48) is expressed in E. coli with an N-terminal His tag . When designing expression systems for membrane proteins like CrcB, several factors should be considered:

  • Codon optimization: Given that accessibility of translation initiation sites significantly impacts recombinant protein expression success rates, codon optimization of the first nine codons can dramatically improve expression levels .

  • Host strain selection: BL21(DE3) derivatives are often preferred for membrane protein expression due to their reduced protease activity.

  • Temperature modulation: Lower induction temperatures (16-25°C) typically yield better results for membrane proteins by allowing proper folding and reducing inclusion body formation.

  • Inducer concentration: Titrating inducer concentrations can help optimize the balance between protein yield and proper folding.

Success rates for recombinant protein expression can vary significantly, with approximately 50% of recombinant proteins failing to be expressed in various host cells . For membrane proteins like CrcB, this percentage may be even higher, making optimization of expression conditions crucial.

What purification strategies work best for obtaining high-purity CrcB homolog protein?

Purification of CrcB homolog requires specialized approaches due to its membrane-embedded nature. The following multi-step purification strategy is recommended:

  • Membrane isolation: After cell lysis, separate membranes by ultracentrifugation.

  • Solubilization: Use appropriate detergents (DDM, LDAO, or C12E8) to extract CrcB from membranes. Optimal detergent concentration should be determined empirically.

  • Affinity chromatography: For His-tagged CrcB, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides efficient capture. Include low concentrations of detergent in all buffers to maintain protein solubility.

  • Size exclusion chromatography: This step separates monomeric protein from aggregates and removes contaminants.

  • Detergent exchange: If necessary for downstream applications, exchange the detergent using size exclusion chromatography or detergent absorption beads.

The purified protein should be stored in buffer containing Tris/PBS, 6% Trehalose, at pH 8.0 . To maintain stability, aliquot and store at -20°C/-80°C, avoiding repeated freeze-thaw cycles. For reconstitution, use deionized sterile water to achieve 0.1-1.0 mg/mL concentration, and consider adding glycerol (5-50% final concentration) for long-term storage .

How can I optimize mRNA accessibility to improve CrcB expression yields?

Recent research has demonstrated that the accessibility of translation initiation sites, modeled using mRNA base-unpairing across the Boltzmann's ensemble, is a critical factor in determining recombinant protein expression success . To optimize CrcB expression:

  • Analyze mRNA secondary structure: Use tools like TIsigner (https://tisigner.com/tisigner) to assess the accessibility of the translation initiation region.

  • Make synonymous substitutions: Modify up to the first nine codons with synonymous substitutions to increase accessibility of the translation initiation site while preserving the amino acid sequence .

  • Balance expression with cellular resources: Higher accessibility leads to higher protein production but may slow cell growth due to the protein cost, where cell growth is constrained by protein circuits during overexpression .

This approach of optimizing mRNA accessibility through synonymous codon changes has been validated through laboratory experiments and computational modeling, and is applicable across prokaryotic and eukaryotic expression systems . Importantly, this method requires minimal changes to the gene of interest, making it a cost-effective approach to improve expression yields.

What experimental methods are most reliable for assessing CrcB fluoride transport activity?

Several complementary approaches can be employed to assess the fluoride transport activity of recombinant CrcB homolog:

  • Fluoride electrode-based assays: Direct measurement of fluoride concentration changes using ion-selective electrodes provides quantitative data on transport rates. This approach requires purified protein reconstituted into liposomes or proteoliposomes.

  • Fluorescence-based assays: Utilizing fluoride-sensitive fluorescent probes to monitor real-time changes in fluoride concentration across membranes. This approach is suitable for both in vitro and cellular systems.

  • Growth-based complementation assays: Expression of CrcB in fluoride-sensitive bacterial strains (e.g., crcB knockout mutants) followed by exposure to varying fluoride concentrations. Restoration of growth in the presence of fluoride indicates functional transport activity .

  • Radioactive fluoride uptake/efflux assays: Using radioactive fluoride isotopes to track movement across membranes, providing high sensitivity for transport measurements.

When designing these experiments, it's essential to include appropriate controls, such as inactive CrcB mutants or empty vector controls, to distinguish specific transport from background permeability.

How can I investigate the relationship between CrcB structure and function through mutagenesis?

Structure-function analysis of CrcB through systematic mutagenesis can provide valuable insights into the molecular mechanism of fluoride transport. The following approach is recommended:

  • Identify conserved residues: Compare CrcB sequences across diverse bacterial species to identify highly conserved amino acids, which likely play critical roles in structure or function.

  • Target transmembrane domains: Focus mutagenesis on predicted transmembrane segments and pore-lining residues that may directly interact with fluoride ions.

  • Charge-altering mutations: Replace charged residues (especially positively charged ones that might interact with fluoride) with neutral or oppositely charged residues.

  • Pore size alterations: Mutate residues predicted to line the channel pore to larger or smaller side chains to assess the impact on ion selectivity and conductance.

  • Accessibility studies: Use cysteine-scanning mutagenesis combined with thiol-reactive reagents to probe the accessibility of different regions of the protein.

For each mutant, measure fluoride transport activity using the methods described in FAQ 3.1 and compare to wild-type CrcB. Correlation of functional changes with specific mutations will help map the critical residues involved in transport and selectivity.

What are the best approaches to study CrcB homolog interaction with other cellular components?

Understanding CrcB's interactions with other cellular components is crucial for elucidating its biological role and regulation. Several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against CrcB or its affinity tag to pull down protein complexes, followed by mass spectrometry to identify interacting partners.

  • Bacterial two-hybrid (B2H) screening: This system allows detection of protein-protein interactions in a bacterial context, which may be more relevant for membrane proteins like CrcB.

  • Fluorescence microscopy: Using fluorescently tagged CrcB to visualize its cellular localization and potential co-localization with other proteins or cellular structures.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry analysis can capture transient interactions and provide information about proximity of specific residues.

  • Lipidomics analysis: To identify specific lipid interactions that may be important for CrcB function or regulation.

When investigating protein-protein interactions involving membrane proteins like CrcB, it's essential to use detergents that maintain native protein conformation while allowing sufficient solubilization for analysis. Additionally, controls for non-specific binding are critical due to the hydrophobic nature of membrane proteins.

How does CrcB homolog contribute to fluoride resistance in bacterial species?

CrcB homolog plays a crucial role in fluoride resistance through several mechanisms:

  • Fluoride efflux: CrcB functions as a transmembrane channel that exports fluoride ions from the cytoplasm to the extracellular environment, preventing intracellular accumulation to toxic levels .

  • Homeostasis maintenance: By regulating intracellular fluoride concentrations, CrcB helps maintain optimal conditions for cellular processes that are sensitive to fluoride inhibition.

  • Protection of metabolic enzymes: Fluoride ions can inhibit various metabolic enzymes, including enolase and pyrophosphatase. CrcB-mediated efflux protects these essential enzymes from inhibition.

Studies in oral streptococci have demonstrated that both crcB1 and crcB2 genes are critical for fluoride resistance, with deletion mutants showing significantly increased sensitivity to fluoride . This evidence supports the essential role of CrcB in bacterial adaptation to environments containing fluoride, which is particularly relevant for oral bacteria regularly exposed to fluoride through dental hygiene products.

What is the relationship between CrcB and pathogenicity in E. coli O6:K15:H31?

While CrcB itself has not been directly implicated as a virulence factor, E. coli O6:K15:H31 (strain 536) possesses several pathogenicity determinants that may interact with or influence CrcB function:

  • Pathogenicity island context: E. coli strain 536 (O6:K15:H31) contains a 79.6-kb pathogenicity island (PAI V536) that includes the K15 capsule determinant, which is important for virulence in urinary tract infections .

  • Stress response integration: CrcB's role in fluoride resistance may be integrated with broader stress response mechanisms that contribute to bacterial survival during infection.

  • Environmental adaptation: By providing resistance against fluoride, CrcB may enhance the ability of pathogenic E. coli to colonize certain niches, particularly in the urinary tract where fluoride may be present.

The K15 capsule of E. coli O6:K15:H31 has been shown to be important for virulence in a murine model of ascending urinary tract infection, though it does not appear to contribute significantly to serum resistance . This suggests that the pathogenicity determinants in this strain play specific roles in different aspects of infection. Further research is needed to determine whether CrcB interacts with these pathogenicity determinants or contributes to virulence in other ways.

How do environmental conditions affect CrcB expression and activity?

Environmental conditions significantly influence CrcB expression and activity through various regulatory mechanisms:

  • Fluoride-dependent regulation: CrcB expression is often upregulated in response to elevated environmental fluoride concentrations, suggesting the presence of fluoride-sensing regulatory systems.

  • pH dependence: The ionic state and permeability of fluoride (HF vs. F-) varies with pH, potentially affecting CrcB activity and the cellular requirement for fluoride efflux.

  • Osmotic conditions: Changes in osmolarity may affect membrane properties and consequently CrcB function or expression.

  • Nutritional status: The metabolic state of the cell, influenced by nutrient availability, may impact CrcB expression through global regulatory networks.

  • Temperature effects: Like many membrane proteins, CrcB activity may be temperature-dependent due to changes in membrane fluidity and protein conformation.

Experimental approaches to study these environmental effects include:

  • qRT-PCR analysis of crcB expression under various conditions

  • Reporter gene assays using the crcB promoter

  • Fluoride transport assays conducted under different environmental conditions

  • Bacterial growth assays in the presence of fluoride under varying environmental parameters

Understanding these environmental dependencies is essential for interpreting experimental results and predicting CrcB function in different ecological niches.

How can CrcB homolog be utilized in synthetic biology applications?

CrcB homolog presents several opportunities for synthetic biology applications:

  • Biosensors: Engineered CrcB-based systems can serve as sensitive fluoride biosensors for environmental monitoring. By coupling CrcB expression or activity to reporter systems (fluorescent proteins, luciferase), quantitative detection of fluoride in various samples can be achieved.

  • Selectable markers: CrcB can function as a selectable marker in synthetic biology systems, allowing selection of successfully transformed cells in fluoride-containing media.

  • Cellular detoxification systems: Engineered cells with optimized CrcB expression could be developed for bioremediation of fluoride-contaminated environments.

  • Model system for ion channel engineering: The relatively simple structure of CrcB makes it an attractive model for studying principles of ion channel engineering and selectivity.

  • Synthetic regulatory circuits: CrcB and its promoter elements can be incorporated into synthetic regulatory networks responsive to fluoride, creating logic gates for synthetic biology applications.

When designing CrcB-based synthetic biology tools, optimization of translation initiation site accessibility through synonymous codon changes can significantly improve expression efficiency, as demonstrated by recent research on recombinant protein production .

What computational approaches can predict CrcB structure-function relationships?

Several computational approaches can provide insights into CrcB structure-function relationships:

  • Homology modeling: Using experimentally determined structures of related proteins as templates to predict CrcB structure. While no CrcB crystal structure is publicly available, structures of related channel proteins can serve as templates.

  • Molecular dynamics simulations: These can model CrcB behavior in a lipid bilayer environment, providing insights into conformational changes, ion permeation, and gating mechanisms.

  • Quantum mechanics/molecular mechanics (QM/MM): For detailed modeling of fluoride ion interactions with specific residues in the channel pore.

  • Evolutionary coupling analysis: Identifying co-evolving residues across CrcB homologs can reveal important functional couplings and structural constraints.

  • Machine learning approaches: Trained on existing ion channel data, these methods can predict functional properties based on sequence features.

  • mRNA structure prediction: Tools like TIsigner can model mRNA accessibility around translation initiation sites, which has been shown to significantly impact recombinant protein expression success .

For implementing these approaches, several software platforms are available:

  • MODELLER or SWISS-MODEL for homology modeling

  • GROMACS, NAMD, or AMBER for molecular dynamics simulations

  • EVfold or DCA for evolutionary coupling analysis

  • TIsigner for mRNA accessibility prediction (https://tisigner.com/tisigner)[5]

What are the cutting-edge techniques for studying CrcB dynamics at the single-molecule level?

Several state-of-the-art techniques enable investigation of CrcB dynamics at unprecedented resolution:

  • Single-channel electrophysiology: Patch-clamp recording of CrcB reconstituted into artificial lipid bilayers or liposomes can reveal individual channel opening/closing events, conductance states, and kinetics of ion permeation.

  • Single-molecule FRET (smFRET): By labeling specific residues in CrcB with donor and acceptor fluorophores, conformational changes can be detected through changes in energy transfer efficiency. This technique can reveal the dynamics of structural changes during transport cycles.

  • High-speed atomic force microscopy (HS-AFM): This technique allows direct visualization of conformational changes in membrane proteins with nanometer resolution and sub-second temporal resolution.

  • Cryo-electron microscopy (cryo-EM): Advanced cryo-EM approaches, particularly those capable of capturing different conformational states, can provide structural insights into the transport mechanism.

  • Molecular dynamics simulations with enhanced sampling: Computational approaches such as metadynamics or replica exchange can explore the free energy landscape of CrcB conformational changes that might be inaccessible to conventional simulations.

When applying these techniques to CrcB, several challenges must be addressed, including protein stability in detergent or membrane mimetics, site-specific labeling strategies for fluorescence experiments, and correlation of single-molecule observations with ensemble functional measurements to develop a comprehensive understanding of transport mechanisms.

What are common challenges in expressing recombinant CrcB homolog and how can they be overcome?

Researchers frequently encounter several challenges when expressing recombinant CrcB homolog:

  • Low expression levels:

    • Problem: As a membrane protein, CrcB often expresses poorly, contributing to the approximately 50% failure rate observed in recombinant protein expression .

    • Solution: Optimize mRNA accessibility at the translation initiation site through synonymous codon substitutions in the first nine codons, which has been shown to significantly improve expression levels . Additionally, try lower induction temperatures (16-20°C) and reduced inducer concentrations.

  • Protein misfolding and aggregation:

    • Problem: Membrane proteins like CrcB are prone to misfolding when overexpressed.

    • Solution: Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ), use specialized E. coli strains (C41/C43), and include membrane-mimetic additives like glycerol in growth media.

  • Toxicity to host cells:

    • Problem: Overexpression of membrane proteins can disrupt host cell membrane integrity.

    • Solution: Use tightly regulated expression systems (e.g., pBAD), test multiple host strains, and optimize induction timing to coincide with mid-log phase growth.

  • Poor solubilization:

    • Problem: Inefficient extraction from membranes during purification.

    • Solution: Screen multiple detergents (DDM, LDAO, C12E8, LMNG) at various concentrations, and consider using detergent mixtures for improved extraction efficiency.

The accessibility of translation initiation sites has been identified as a key predictor of expression success across diverse species, outperforming alternative features in predicting successful expression of 11,430 recombinant proteins . Utilizing tools like TIsigner to optimize this parameter can significantly improve success rates.

How can I troubleshoot inconsistent results in fluoride transport assays with CrcB?

Inconsistent results in fluoride transport assays with CrcB can stem from multiple sources:

  • Protein quality issues:

    • Problem: Variable protein activity due to partial denaturation or heterogeneous preparations.

    • Solution: Implement rigorous quality control steps, including SEC-MALS to confirm monodispersity, circular dichroism to verify secondary structure, and activity assays with known controls.

  • Reconstitution variability:

    • Problem: Inconsistent incorporation of CrcB into liposomes or proteoliposomes.

    • Solution: Standardize reconstitution protocols, verify protein orientation and density using protease protection assays, and quantify protein:lipid ratios for each preparation.

  • Buffer composition effects:

    • Problem: Fluoride speciation (F- vs. HF) varies with pH, affecting transport measurements.

    • Solution: Strictly control buffer pH (±0.1 units), use consistent buffer compositions, and consider the influence of divalent cations which may interact with fluoride.

  • Detection method limitations:

    • Problem: Fluoride electrode drift or interference from other ions.

    • Solution: Calibrate electrodes frequently, minimize experiment duration, and include appropriate controls for each experimental session.

  • Temperature fluctuations:

    • Problem: Membrane fluidity and protein dynamics are temperature-dependent.

    • Solution: Use temperature-controlled chambers and allow sufficient equilibration time before measurements.

A systematic approach to troubleshooting involves:

  • Documenting all experimental parameters in detail

  • Testing one variable at a time

  • Including appropriate positive and negative controls in each experiment

  • Verifying protein quality before functional assays

What strategies can address the challenges of structural studies with CrcB homolog?

Structural studies of membrane proteins like CrcB present unique challenges requiring specialized approaches:

  • Protein stability issues:

    • Problem: CrcB may be unstable in detergent solutions required for many structural techniques.

    • Solution: Implement thermostability assays (CPM-based thermal shift) to screen multiple detergents and additives. Consider protein engineering approaches such as thermostabilizing mutations or fusion partners.

  • Conformational heterogeneity:

    • Problem: Multiple conformational states can complicate structural determination.

    • Solution: Use ligands or inhibitors to trap specific conformational states. Consider nanobodies or antibody fragments as conformational stabilizers.

  • Crystallization difficulties:

    • Problem: Membrane proteins like CrcB are notoriously difficult to crystallize.

    • Solution: Explore lipidic cubic phase (LCP) crystallization, which better mimics the membrane environment. Screen fusion partners (e.g., T4 lysozyme, BRIL) that can provide crystal contacts.

  • Cryo-EM challenges:

    • Problem: Small membrane proteins like CrcB (127 amino acids) are at the lower size limit for cryo-EM.

    • Solution: Consider antibody fragment complexes to increase particle size. Use approaches like the Volta phase plate to enhance contrast.

  • NMR spectroscopy considerations:

    • Problem: Size limitations and spectral complexity.

    • Solution: Employ selective isotope labeling strategies and deuteration to simplify spectra. Consider solid-state NMR approaches for CrcB in a native-like membrane environment.

The development of membrane mimetics beyond traditional detergents, such as nanodiscs, amphipols, and styrene-maleic acid copolymer lipid particles (SMALPs), offers promising alternatives for stabilizing CrcB in near-native environments for structural studies.

What are emerging research questions regarding CrcB homolog and fluoride transport mechanisms?

Several exciting research directions are emerging in the field of CrcB biology and fluoride transport:

  • Structural basis of selectivity: While CrcB is known to transport fluoride, the molecular determinants of its selectivity over other halides remain poorly understood. Determining how CrcB discriminates between fluoride and other ions would provide fundamental insights into ion channel selectivity mechanisms.

  • Regulatory networks: How is CrcB expression regulated in response to environmental fluoride? Identifying the transcriptional and post-transcriptional regulatory mechanisms could reveal new paradigms in bacterial stress responses.

  • Evolutionary adaptations: CrcB homologs are found across diverse bacterial species, including those from extreme environments. Comparative studies could reveal how these channels have adapted to different ecological niches and fluoride concentrations.

  • Interaction with cellular metabolism: Does CrcB function integrate with broader metabolic networks? Studies examining how fluoride transport impacts central metabolism and stress responses could provide a systems-level understanding of CrcB function.

  • Potential as antimicrobial target: Given the importance of CrcB for fluoride resistance, could inhibition of CrcB sensitize certain pathogens to fluoride? This could open new avenues for antimicrobial development.

Addressing these questions will require interdisciplinary approaches combining structural biology, electrophysiology, genetics, and computational modeling.

How might CRISPR-Cas9 and other genetic engineering technologies advance CrcB research?

CRISPR-Cas9 and related technologies offer transformative approaches for CrcB research:

  • Precise genome editing:

    • Generate clean knockouts of crcB genes without polar effects on adjacent genes

    • Introduce point mutations to test structure-function hypotheses in the native genomic context

    • Create tagged versions of CrcB at the endogenous locus for localization studies

  • High-throughput functional screening:

    • CRISPR interference (CRISPRi) libraries targeting different regions of crcB to identify critical functional domains

    • CRISPR activation (CRISPRa) approaches to upregulate crcB expression and assess effects on fluoride resistance

    • Pooled CRISPR screens to identify genetic interactions with crcB

  • Base and prime editing applications:

    • Introduce specific amino acid substitutions without double-strand breaks

    • Systematically alter the CrcB coding sequence to test specific hypotheses

    • Modify regulatory regions to understand transcriptional control

  • In vivo dynamics:

    • CRISPR-based imaging techniques to visualize CrcB localization in living cells

    • Optogenetic control of CrcB expression to study temporal aspects of fluoride resistance

These approaches can be complemented by high-throughput phenotyping methods and next-generation sequencing to rapidly accelerate our understanding of CrcB function and regulation.

What interdisciplinary approaches could provide new insights into CrcB function and applications?

Interdisciplinary approaches at the intersection of multiple fields offer promising avenues for CrcB research:

  • Synthetic biology and materials science:

    • Development of CrcB-based fluoride-responsive biomaterials

    • Integration of CrcB into synthetic cells or protocells to study minimal requirements for fluoride homeostasis

    • Creation of fluoride-capturing surfaces for water purification using immobilized CrcB

  • Systems biology and computational modeling:

    • Multi-scale modeling from molecular dynamics to whole-cell physiology

    • Integration of CrcB function into genome-scale metabolic models

    • Network analysis to understand how fluoride transport impacts cellular processes

  • Microbiome research and ecology:

    • Examining the role of CrcB in microbiome communities exposed to fluoride

    • Studying how fluoride resistance via CrcB affects microbial community structure

    • Investigating horizontal gene transfer patterns of crcB genes in natural environments

  • Structural biology and medicinal chemistry:

    • Structure-based design of CrcB inhibitors as potential antimicrobials

    • Development of fluoride mimetics that interact with CrcB

    • Computational approaches to identify allosteric modulators of CrcB function

  • Biotechnology and environmental engineering:

    • Engineering CrcB variants with enhanced fluoride transport for bioremediation

    • Development of whole-cell biosensors for environmental fluoride detection

    • Integration of CrcB into membrane technologies for selective fluoride removal

These interdisciplinary approaches can leverage diverse expertise to address complex questions about CrcB biology and develop novel applications based on its unique properties as a fluoride transporter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.