Recombinant Escherichia coli O6:K15:H31 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

GlpG cleaves transmembrane domains of substrates at hydrophilic juxtamembrane regions rather than within deeply buried helices . Key functional attributes include:

  • Catalytic Mechanism: Hydrolysis occurs via a nucleophilic serine protease mechanism, with water molecules activated by the Ser-His dyad .

  • Substrate Recognition: Prefers substrates with small residues (e.g., Gly, Ala) at the P1 position and helix-destabilizing motifs in transmembrane regions .

  • In Vitro Activity: Cleaves model substrates (e.g., Bla-LY2-MBP) between Ser and Asp residues in vitro .

Research Applications

Recombinant GlpG has been instrumental in:

  • Mechanistic Studies: Elucidating gating mechanisms and water-mediated catalysis in intramembrane proteolysis .

  • Drug Discovery: Serving as a model for designing inhibitors against pathogenic rhomboid proteases .

  • Bacterial Physiology: Investigating roles in fatty acid β-oxidation and gut colonization by E. coli .

Biological Significance in E. coli

GlpG contributes to bacterial fitness by:

  • Metabolic Regulation: Enabling glycerol degradation via transcriptional derepression of glp operon genes .

  • Nutrient Utilization: Enhancing growth on long-chain fatty acids (e.g., oleate) as carbon sources .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
glpG; ECP_3509; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: ecp:ECP_3509

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is GlpG and what is its significance in E. coli?

GlpG is a membrane-embedded protease in Escherichia coli that belongs to the widely conserved rhomboid family of membrane proteases. It functions as a key player in regulated intramembrane proteolysis, a critical cellular process for protein maturation and signaling. From a structural perspective, GlpG traverses the bacterial membrane six times, establishing its characteristic topology as verified through experimental analysis . The significance of GlpG extends beyond E. coli as it serves as a prototype for understanding serine intramembrane proteases across multiple organisms, making it valuable for fundamental research in protein biochemistry and membrane biology .

What is the basic topology and membrane orientation of GlpG?

GlpG has a well-characterized membrane topology consisting of six transmembrane segments that span the bacterial membrane. Experimental verification has confirmed this predicted topology . The protein adopts a specific orientation within the membrane that is critical for its proteolytic function. The active site residues are positioned to allow substrate access within the membrane environment, creating a catalytic pocket where proteolysis occurs. This orientation enables GlpG to recognize and cleave substrate proteins at specific sites within or adjacent to transmembrane regions. Understanding this topology is essential for interpreting experimental results related to substrate specificity and catalytic mechanism .

Which amino acid residues are essential for GlpG's catalytic activity?

The proteolytic activity of GlpG depends critically on specific conserved amino acid residues that form its catalytic machinery. Experimental studies have demonstrated that conserved serine (Ser) and histidine (His) residues are absolutely essential for the proteolytic activities of GlpG . These residues function similarly to the catalytic triad in classical serine proteases, though with adaptations for the membrane environment. Site-directed mutagenesis experiments where these residues are replaced result in loss of catalytic function, confirming their essential role. Crystal structure analysis has further elucidated how these residues are positioned within the active site to facilitate nucleophilic attack on substrate peptide bonds during the proteolytic reaction .

What are the optimal conditions for recombinant expression of GlpG in E. coli?

For optimal expression of recombinant GlpG in E. coli, researchers should use an expression system with an N-terminal His₆ tail to facilitate purification. The most effective approach involves using a truncated GlpG construct that lacks the N-terminal cytoplasmic domain, as this improves expression yields and protein stability. The expression protocol should include the following steps:

  • Transform the GlpG expression plasmid into an appropriate E. coli strain optimized for membrane protein expression

  • Culture cells at 37°C until reaching mid-log phase (OD₆₀₀ of 0.6-0.8)

  • Induce protein expression with IPTG (typically 0.5-1.0 mM)

  • Continue growth at a reduced temperature (16-25°C) for 12-18 hours to maximize proper folding

  • Harvest cells by centrifugation and proceed with membrane fraction isolation

This approach has been validated in studies that successfully expressed GlpG for structural and functional analyses . The absence of the cytoplasmic domain also provides experimental advantages by eliminating additional tryptophan residues that can complicate spectroscopic measurements during structural analysis .

How can purified GlpG be stabilized for in vitro biochemical assays?

Stabilizing purified GlpG for in vitro biochemical assays requires careful consideration of detergent selection and buffer composition. Based on experimental evidence, the following methodology provides optimal stability:

  • Purify GlpG using nickel-nitrilotriacetate (Ni-NTA) chromatography with appropriate detergent in all buffers

  • Utilize a mixed micelle system containing n-dodecyl-β-D-maltoside (DDM) as the primary detergent

  • Maintain a low concentration of sodium dodecyl sulfate (SDS) with mole fraction (MFSDS) below 0.5 to preserve the native structure

  • Include glycerol (10-15%) in storage buffers to enhance stability

  • Maintain pH between 7.0-8.0 with appropriate buffering agents such as HEPES or Tris

  • Add small amounts of reducing agents (1-2 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

SAXS data indicates that the size and shape of detergent micelles surrounding GlpG change significantly with detergent composition, affecting protein stability. At both low and high MFSDS, micelles are relatively small with aggregation numbers around 80 and moderate eccentricity (values around 2-3), while intermediate MFSDS values create larger and more eccentric micelles . These findings suggest that maintaining appropriate detergent composition is critical for preserving the native structure and function of GlpG in solution.

What model substrate systems have been developed to assess GlpG activity in vitro?

To assess GlpG proteolytic activity in vitro, researchers have developed specialized model substrate systems that mimic the natural targets of rhomboid proteases. One effective approach utilizes a chimeric protein with the following components:

  • An N-terminal periplasmically localized β-lactamase (Bla) domain

  • A LacY-derived transmembrane region serving as the recognition element

  • A cytosolic maltose binding protein (MBP) mature domain

This three-part chimeric protein has been experimentally validated to undergo GlpG-dependent cleavage both in vivo and with purified components in vitro . The cleavage occurs between serine and aspartic acid residues in a region of high local hydrophilicity, likely in a juxtamembrane rather than intramembrane position. This model substrate system allows researchers to quantitatively assess GlpG activity under various experimental conditions.

Alternative approaches for monitoring activity include:

  • Fluorogenic peptide substrates with appropriate transmembrane-mimicking sequences

  • FRET-based assays using donor-acceptor labeled substrate proteins

  • Gel-based activity assays with immunoblotting detection of cleavage products

Each method offers different advantages for specific experimental questions about GlpG catalytic activity and substrate specificity .

How does GlpG recognize its substrate proteins?

GlpG recognizes its substrate proteins primarily through specific features of the transmembrane regions rather than strict sequence specificity. Experimental evidence using variant forms of model proteins suggests that GlpG interacts with structural elements in the substrate's transmembrane domain . The recognition process involves:

  • Initial recognition of hydrophobic patterns in the substrate's transmembrane segment

  • Positioning of the substrate cleavage site within the active site pocket

  • Stabilization of the substrate through interactions with surrounding residues

This recognition mechanism allows GlpG to process diverse substrates while maintaining specificity. The enzyme appears to have evolved to recognize common structural features rather than specific amino acid sequences, which explains its ability to cleave various targets within the membrane environment . Research using model substrates with systematically altered transmembrane domains has been particularly valuable in elucidating these recognition principles.

What is the proposed catalytic mechanism of GlpG?

The catalytic mechanism of GlpG follows a serine protease-like pathway that has been adapted for the membrane environment. Crystal structure analysis of GlpG in complex with diisopropyl fluorophosphonate at 2.3 Å resolution has provided valuable insights into this mechanism . The proposed catalytic steps include:

  • Initial binding of the substrate transmembrane region through hydrophobic interactions

  • Positioning of the scissile bond near the catalytic serine residue

  • Nucleophilic attack by the activated serine on the carbonyl carbon of the scissile bond

  • Formation of a tetrahedral transition state, stabilized by an oxyanion hole

  • Cleavage of the peptide bond and release of the first product fragment

  • Hydrolysis of the acyl-enzyme intermediate and release of the second product fragment

The crystal structure of the inhibitor-bound complex provides a model for the tetrahedral transition state and reveals conformational changes that occur within the active site during catalysis . These conformational changes are essential for accommodating the substrate and facilitating the proteolytic reaction within the membrane bilayer.

How does the membrane environment influence GlpG stability and function?

The membrane environment plays a critical role in GlpG stability and function, as demonstrated by studies using detergent micelles of varying compositions. When examining GlpG stability in mixed micelles of SDS and DDM, researchers observed non-monotonic changes in protein stability with varying mole fractions of SDS (MFSDS) . The following key observations highlight this relationship:

  • GlpG shows differential stability patterns at different MFSDS values, with complex behavior at low SDS concentrations

  • SAXS data reveals that micelle size and shape change significantly with detergent composition:

    • At both low and high MFSDS, micelles are relatively small (aggregation numbers ~80) and moderately eccentric (values ~2-3)

    • At intermediate MFSDS values, micelles become larger (nearly doubling in size) and highly eccentric

This relationship between micelle properties and protein stability suggests that the membrane environment provides specific physical constraints that are necessary for proper GlpG folding and function. Different regions of the protein show varying sensitivities to these environmental changes, as demonstrated by position-specific Cys-labeling kinetics . These findings have important implications for experimental design when studying GlpG outside its native membrane environment.

How can Cys-labeling kinetics be used to probe GlpG structural dynamics?

Cys-labeling kinetics represents a powerful approach for investigating the structural dynamics of GlpG under various conditions. This methodology provides insights into both local and global conformational changes in the protein. The experimental approach involves:

  • Creating single-cysteine mutants at specific positions throughout the GlpG structure

  • Measuring the rate of reaction with thiol-specific probes (such as DTNB) under various conditions

  • Analyzing the kinetic data using appropriate models to extract information about protein conformational states

Research has revealed significant position-specific differences in labeling rates, with approximately 10-fold variation in intrinsic labeling rates (kint) for the native state across different positions in GlpG. For example:

Mutant PositionNative State kint (relative units)Denatured State kint (relative units)Relative Accessibility (Ų)
WT/L155CLowestVariable14 ± 3
G240CHighestVariable33 ± 5
S181CLowVariable12 ± 7
C211MediumVariable14 ± 3
C260MediumVariable18 ± 5
C100MediumVariable23 ± 5

These differences reflect local variations in accessibility and reactivity, providing a map of structural dynamics across the protein. Molecular dynamics simulations have confirmed that residues like Cys240 in loop regions show significantly higher surface accessibility (33 ± 5 Ų) compared to more buried positions . This approach is particularly valuable for studying how membrane protein structure changes in response to environmental perturbations.

What insights have crystallographic studies provided about GlpG catalytic intermediates?

Crystallographic studies have provided crucial insights into the catalytic intermediates of GlpG by capturing the enzyme in different states along the reaction pathway. Key findings from these studies include:

  • The crystal structure of GlpG in complex with diisopropyl fluorophosphonate solved at 2.3 Å resolution provides a model for the tetrahedral transition state

  • This structure reveals specific conformational changes within the active site that accompany substrate binding and catalysis

  • The positioning of the catalytic serine and histidine residues confirms their roles in the nucleophilic attack mechanism

  • The structure provides evidence for an oxyanion hole that stabilizes the developing negative charge during catalysis

These structural insights are fundamental to understanding the mechanism of intramembrane proteolysis by rhomboid proteases . The crystallographic data have allowed researchers to propose detailed models of substrate binding, catalysis, and product release that explain how GlpG functions within the membrane environment. This information is essential for developing specific inhibitors or engineered variants with modified activities for biotechnological applications.

How can molecular dynamics simulations complement experimental studies of GlpG?

Molecular dynamics (MD) simulations provide valuable complementary information to experimental studies of GlpG by modeling atomic-level details of protein-membrane interactions that are difficult to capture experimentally. An effective approach for MD simulations of GlpG includes:

  • Building realistic GlpG-micelle systems using tools like CHARMM-GUI

  • Incorporating appropriate numbers of detergent molecules (e.g., 176 DDM molecules and 80 SDS molecules)

  • Using all-atom force fields for energy minimization and simulation

  • Running extended simulations (500+ ns) to capture relevant conformational changes

  • Analyzing the last portion of the simulation (e.g., 200 ns) for stable property calculations

MD simulations have successfully predicted surface accessibilities of cysteine residues in different positions within GlpG, showing good agreement with experimental Cys-labeling data for some positions. For example, simulations correctly identified Cys240 as having the highest accessibility (33 ± 5 Ų) compared to more buried positions like Cys181 (12 ± 7 Ų) .

What are the current limitations in studying GlpG and other rhomboid proteases?

Despite significant progress, researchers face several methodological challenges when studying GlpG and other rhomboid proteases:

  • Maintaining native-like conditions during purification and analysis remains difficult due to the critical influence of the membrane environment on protein structure and function

  • Current detergent-based systems introduce artifacts that can complicate data interpretation, as evidenced by the complex relationship between micelle properties and protein stability

  • Identifying physiological substrates in bacterial systems presents challenges due to limited knowledge of natural targets

  • Developing high-throughput activity assays for rhomboid proteases is complicated by the need for membrane-embedded substrates

  • Capturing transient catalytic intermediates requires specialized approaches that are technically demanding

These limitations highlight the need for continued methodological innovation in the field. Emerging approaches such as nanodiscs and lipid cubic phase crystallization offer potential solutions for maintaining more native-like environments during experimental studies. Additionally, improved computational methods may help bridge gaps between experimental observations and molecular-level understanding of rhomboid protease function .

How can knowledge about GlpG inform studies of eukaryotic rhomboid proteases?

Knowledge derived from studying the bacterial GlpG can significantly inform research on eukaryotic rhomboid proteases through comparative analysis of conserved features and mechanisms. Key translational aspects include:

  • GlpG serves as a structural prototype for the entire rhomboid protease family, with core catalytic mechanisms likely conserved across species

  • Experimental methodologies developed for GlpG, such as model substrate systems and activity assays, can be adapted for eukaryotic homologs

  • Understanding substrate recognition principles in GlpG provides a framework for investigating specificity in eukaryotic systems

  • Insights into how membrane environment affects GlpG structure and function inform studies of eukaryotic rhomboids in different cellular compartments

What novel applications of recombinant GlpG are being explored in biotechnology?

Recombinant GlpG is being explored for several innovative biotechnological applications that leverage its unique catalytic properties and substrate specificity:

  • Development of engineered proteases with modified specificity for targeted protein processing applications

  • Creation of biosensors that use rhomboid-based reporter systems to detect membrane protein interactions

  • Utilization as a tool for studying membrane protein topology and folding dynamics

  • Potential applications in synthetic biology for creating novel signaling pathways based on regulated proteolysis

These applications build on the fundamental understanding of GlpG structure, function, and catalytic mechanism derived from basic research. While still in developmental stages, these approaches demonstrate how basic research on membrane proteases can lead to practical biotechnological innovations. Further exploration of these applications requires continued refinement of expression, purification, and activity assay methodologies to improve protein yield and stability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.