Recombinant Escherichia coli O6:K15:H31 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant UgpA is a 295-amino acid permease protein expressed in E. coli with an N-terminal His tag for purification . Key features include:

PropertyDescription
UniProt IDQ0TC08
Gene NameugpA (synonyms: ECP_3545)
Expression SystemE. coli
Molecular CharacteristicsFull-length, 34.5 kDa theoretical molecular weight
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -20°C/-80°C

Functional Role in Bacterial Physiology

UgpA is a component of the ATP-binding cassette (ABC) transporter system responsible for importing sn-glycerol-3-phosphate (G3P) under phosphate-limiting conditions . Key functional insights include:

  • Regulation: Induced by phosphate starvation via the pho regulon .

  • Transport Mechanism:

    • Requires periplasmic binding protein UgpB and membrane components UgpA/UgpE .

    • Transports G3P and glyceryl phosphoryl phosphodiesters but does not support growth on G3P as a sole carbon source .

  • Metabolic Fate: Internalized G3P is primarily incorporated into phospholipids or degraded to release inorganic phosphate (Pi) .

Sequence and Domains

  • The amino acid sequence includes transmembrane helices consistent with its role as a permease .

  • Critical residues for transport activity are inferred from homology with other ABC transporters .

Stability and Reconstitution

  • Reconstitution: Requires dilution in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Sensitivity: Loses activity upon repeated freeze-thaw cycles .

Research Applications

Recombinant UgpA is utilized in:

  1. Transport Studies: Investigating ABC transporter dynamics under phosphate stress .

  2. Pathogen Virulence: E. coli O6:K15:H31 strain 536, a uropathogenic isolate, employs UgpA during infection to scavenge phosphate in host environments .

  3. Structural Biology: Crystallization trials to resolve membrane protein architectures .

Key Research Findings

Study FocusResultSource
Ugp System InductionUgpA expression increases 10-fold under phosphate starvation .
Metabolic InhibitionInternal Pi accumulation inhibits Ugp-mediated G3P uptake, creating feedback regulation .
Pathogenicity LinkStrain 536 (O6:K15:H31) harbors virulence factors (e.g., hemolysins, fimbriae) but UgpA’s direct role remains uncharacterized .

Future Directions

  • Mechanistic Studies: Resolving UgpA’s role in cross-talk between phosphate and carbon metabolism.

  • Therapeutic Potential: Targeting UgpA in pathogenic E. coli strains to disrupt phosphate acquisition during infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ugpA; ECP_3545; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
ugpA
Target Protein Sequence
MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV TLFHDSYYLDAFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA LQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG GPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVEGKVRYQ
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for sn-glycerol-3-phosphate. Its primary function is likely the transmembrane translocation of this substrate.
Database Links

KEGG: ecp:ECP_3545

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ugpA protein and what role does it play in E. coli O6:K15:H31?

The ugpA protein functions as a permease component of the ugp-dependent transport system for sn-glycerol-3-phosphate in Escherichia coli. This system is specifically induced under phosphate-limiting conditions or in mutants that exhibit constitutive expression of the pho regulon, which regulates phosphate metabolism in the bacterium. The transport system participates in the cellular acquisition of sn-glycerol-3-phosphate, which can serve as a phosphate source for the organism when external inorganic phosphate is limited .

In the E. coli O6:K15:H31 serotype, which has been identified as both an enterotoxigenic and uropathogenic strain, the ugpA protein may contribute to virulence by facilitating phosphate acquisition during infection. The O6:K15 serotype has been frequently isolated from children with diarrhea and is known to occur at high frequency in combination with a mannose-resistant hemagglutinin, suggesting its clinical significance .

Under what conditions is the ugp transport system induced in E. coli?

The ugp-dependent transport system for sn-glycerol-3-phosphate demonstrates a highly regulated expression pattern in E. coli. This system is primarily induced under two specific conditions:

  • Phosphate starvation conditions: When available phosphate in the environment becomes limiting, E. coli induces multiple systems to acquire this essential nutrient, including the ugp transport system.

  • Genetic mutations affecting the pho regulon: In mutants that are constitutive for the pho regulon (the phosphate regulon), the ugp system is expressed regardless of phosphate availability .

The induction mechanism allows E. coli to adapt to environments with varying phosphate availability by selectively expressing transport systems when needed. This regulation is part of a sophisticated response that helps the bacterium maintain phosphate homeostasis under changing environmental conditions.

How does the ugp transport system function at the biochemical level?

Several key biochemical properties distinguish this transport system:

  • It does not operate in membrane vesicles, indicating a requirement for intact cellular architecture.

  • It displays high sensitivity to osmotic shock, which disrupts the periplasmic compartment.

  • The system can transport both sn-glycerol-3-phosphate and toxic analogs like 3,4-dihydroxybutyl-1-phosphonate .

What experimental design approaches are most effective for studying ugpA function in E. coli O6:K15:H31?

When investigating ugpA function in E. coli O6:K15:H31, researchers should implement true experimental designs that properly control variables and establish causality. A systematic approach involves:

Variable Identification and Control:

  • Independent variables: Phosphate concentration, expression level of ugpA, structural modifications to ugpA

  • Dependent variables: Transport rate of sn-glycerol-3-phosphate, incorporation into cellular components, growth under various conditions

  • Extraneous variables requiring control: Temperature, pH, osmolarity, growth phase, genetic background

Recommended Experimental Framework:

Design ComponentImplementation Strategy
Control GroupsUtilize isogenic strains lacking ugpA or with non-functional variants
Variable ManipulationEmploy inducible promoters for controlled expression of ugpA
RandomizationRandom distribution of bacterial cultures to treatment conditions
ReplicationMinimum triplicate biological and technical replicates

The most robust approach employs a factorial design to test multiple variables simultaneously, allowing for analysis of interactions between phosphate availability, ugpA expression levels, and potential regulatory factors. This design should incorporate both phenotypic assays measuring transport function and molecular analyses identifying protein interactions and structural requirements .

For genetic studies of ugpA, the selection of resistant mutants against toxic analogs like 3,4-dihydroxybutyl-1-phosphonate provides a powerful tool for identifying functional domains and essential residues within the permease protein .

How should researchers address contradictory data when studying the regulation of ugpA expression?

When researchers encounter data that contradicts established models of ugpA regulation, a systematic analytical framework should be implemented:

Step 1: Thorough Examination of Data Discrepancies
Begin by identifying specific contradictions between expected and observed results. Compare your findings with published literature on ugpA regulation, paying particular attention to strain differences, experimental conditions, and measurement techniques that may explain the contradictions .

Step 2: Critical Evaluation of Experimental Design
Assess potential methodological limitations that might have influenced results:

  • Validate strain identity through whole genome sequencing or PCR confirmation of the O6:K15:H31 serotype

  • Verify experimental conditions precisely match those reported in conflicting studies

  • Examine reagent quality and potential contamination issues

  • Review statistical approaches for potential errors in analysis

Step 3: Consider Alternative Hypotheses
Develop new models that might explain the contradictory results. For example, if ugpA expression occurs under high phosphate conditions (contradicting established knowledge), consider:

  • Potential cross-regulation by other stress response pathways

  • Strain-specific mutations in regulatory elements

  • Post-transcriptional or post-translational regulatory mechanisms

  • Presence of additional transport systems with overlapping function

Step 4: Design Validation Experiments
Implement orthogonal techniques to verify contradictory observations:

Validation ApproachApplication to ugpA Research
qRT-PCRQuantify ugpA transcript levels under various conditions
Reporter Fusion AssaysMonitor promoter activity in real-time
ProteomicsMeasure UgpA protein levels with and without phosphate limitation
Binding StudiesCharacterize interactions between regulatory proteins and ugpA promoter

By systematically addressing contradictions through these steps, researchers can either reconcile disparate findings or discover novel regulatory mechanisms governing ugpA expression in E. coli O6:K15:H31 .

What is the relationship between ugpA and the capsular polysaccharide structure in E. coli O6:K15?

While direct evidence linking ugpA and the K15 capsular polysaccharide structure is limited in the provided search results, several hypotheses can be formulated based on the biological context:

The K15 capsular polysaccharide has a defined repeating structure consisting of 4)-α-Glc pNAc-(1 → 5)-α-KDO p-(2 → partially O-acetylated at 3-hydroxyl of GlcNAc . This structure represents a significant virulence factor in pathogenic E. coli strains.

The relationship between ugpA and capsular synthesis might involve:

  • Phosphate Provision: The ugp transport system may indirectly support capsular polysaccharide synthesis by providing phosphate under limiting conditions, which is essential for the energy-intensive process of polysaccharide biosynthesis.

  • Precursor Transport: Though primarily associated with sn-glycerol-3-phosphate transport, the ugp system might participate in the transport of precursors needed for KDO synthesis, a key component of the K15 capsule.

  • Regulatory Interplay: The expression of ugpA and capsular genes might be co-regulated under specific environmental conditions encountered during infection.

To investigate these potential relationships, researchers should design experiments that:

  • Generate mutants defective in ugpA and assess impacts on capsule production

  • Perform metabolic labeling studies to track phosphate incorporation from sn-glycerol-3-phosphate into capsular components

  • Analyze transcriptional profiles to identify co-regulation patterns between ugpA and capsular biosynthesis genes

These approaches would illuminate the potential functional connection between phosphate acquisition via UgpA and capsular polysaccharide production in E. coli O6:K15:H31.

What methods can be used to isolate and characterize the ugpA protein from E. coli O6:K15:H31?

Isolation and characterization of the ugpA protein requires a multi-step approach combining molecular genetics, protein biochemistry, and functional analysis techniques:

Isolation Protocol:

  • Recombinant Expression System Development:

    • Clone the ugpA gene from E. coli O6:K15:H31 into an expression vector with an affinity tag (His6 or FLAG)

    • Transform into an expression host strain (preferably a ugpA-deficient E. coli)

    • Induce expression under phosphate-limiting conditions to maximize yield

  • Membrane Protein Extraction:

    • Harvest cells and disrupt by sonication or French press

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

    • Solubilize membrane proteins using appropriate detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Affinity Purification:

    • Apply solubilized membrane fraction to affinity resin

    • Wash extensively to remove non-specifically bound proteins

    • Elute purified ugpA protein using imidazole gradient or specific peptide

Characterization Methods:

TechniqueInformation ObtainedExperimental Parameters
Western BlotProtein expression level, molecular weightUse anti-His or anti-ugpA antibodies
Mass SpectrometryProtein identity, post-translational modificationsLC-MS/MS analysis of tryptic digests
Circular DichroismSecondary structure compositionScan 190-260 nm in detergent micelles
Size Exclusion ChromatographyOligomeric state, complex formationRun on Superdex 200 column with detergent
Transport AssaysFunctional activityMeasure uptake of [14C]-labeled sn-glycerol-3-phosphate

For structural studies, researchers should consider reconstituting purified ugpA into proteoliposomes or nanodiscs to maintain native-like membrane environment. This approach preserves protein function and enables detailed characterization of transport kinetics and substrate specificity .

How can researchers measure the activity of the ugp transport system in various experimental conditions?

Measuring the activity of the ugp transport system requires specialized techniques that account for its unique properties, including binding protein dependence and sensitivity to osmotic shock :

In Vivo Transport Assays:

  • Radioisotope Uptake Measurement:

    • Grow E. coli O6:K15:H31 under phosphate-limiting conditions to induce the ugp system

    • Harvest cells and resuspend in appropriate buffer maintaining osmotic stability

    • Add [14C]-labeled sn-glycerol-3-phosphate to cells

    • At timed intervals, filter samples and wash with cold buffer to remove extracellular label

    • Measure cell-associated radioactivity by scintillation counting

  • Competition Assays:

    • Perform uptake assays as above, but include varying concentrations of unlabeled potential substrates

    • Calculate IC50 values to determine relative affinities for different compounds

    • This approach can identify the substrate range of the transport system

Quantitative Analysis Parameters:

ParameterCalculation MethodTypical Values
VmaxNon-linear regression of Michaelis-Menten equation5-50 nmol/min/mg protein
KmNon-linear regression of Michaelis-Menten equation0.1-10 μM for sn-glycerol-3-phosphate
Transport SpecificityRatio of transport rates with/without competitor>10 for specific substrates
Induction RatioTransport rate in low Pi vs. high Pi>20-fold increase in low Pi

Genetic Approaches to Measure Activity:

Researchers can employ mutant strains to dissect the contribution of specific components:

  • Compare transport in wild-type vs. ugpA deletion strains

  • Measure transport in strains lacking the periplasmic binding protein

  • Assess activity in pho regulon constitutive mutants

These approaches provide comprehensive insights into the kinetics, regulation, and substrate specificity of the ugp transport system under varying experimental conditions .

What genetic manipulation techniques are most effective for studying ugpA function?

For comprehensive investigation of ugpA function in E. coli O6:K15:H31, researchers should employ a strategic combination of genetic manipulation techniques:

1. Targeted Gene Deletion and Complementation:

  • Generate precise ugpA deletion mutants using λ Red recombineering or CRISPR-Cas9

  • Create complementation constructs with wild-type ugpA under native or inducible promoters

  • Analyze phenotypic changes in transport function, phosphate utilization, and growth under limiting conditions

2. Site-Directed Mutagenesis:

  • Introduce specific amino acid substitutions to identify functional residues in transmembrane domains

  • Create chimeric proteins by domain swapping with homologous transporters

  • Design alanine-scanning libraries targeting predicted substrate-binding regions

3. Reporter Fusions:

  • Construct transcriptional fusions (ugpA promoter-lacZ/gfp) to monitor expression

  • Generate translational fusions maintaining membrane topology to study localization

  • Develop protein complementation assays to identify interaction partners

4. Selection Strategies:

  • Utilize toxic analogs like 3,4-dihydroxybutyl-1-phosphonate for positive selection of transport-deficient mutants

  • Develop phosphate-utilization screens to identify functional variants under selective conditions

Advanced Genetic Manipulation Approaches:

TechniqueApplication to ugpA ResearchExpected Outcome
TraDIS/Tn-SeqGenome-wide screening for genes affecting ugpA functionIdentification of regulatory networks
CRISPRiTunable repression of ugpA expressionDose-dependent phenotypic analysis
Multiplexed CRISPR EditingSimultaneous modification of multiple transport system componentsDissection of complex phenotypes
Recombineering with ssDNAIntroduction of specific mutations without selection markersAnalysis of subtle sequence variations

These genetic approaches, when combined with functional assays measuring transport activity, provide powerful tools for elucidating the structure-function relationships within ugpA and its interaction with other components of the phosphate transport network .

What statistical approaches are most appropriate for analyzing ugpA transport activity data?

The analysis of ugpA transport activity data requires statistical approaches that address the complexities of enzyme kinetics, biological variation, and experimental design considerations:

Basic Statistical Analysis Framework:

  • Descriptive Statistics:

    • Calculate mean, median, standard deviation, and coefficient of variation for transport rates

    • Identify outliers using methods like Grubbs' test or box plots

    • Assess normality of distribution using Shapiro-Wilk or Kolmogorov-Smirnov tests

  • Inferential Statistics for Comparative Studies:

    • For comparing two conditions (e.g., wild-type vs. mutant): paired or unpaired t-tests

    • For multiple experimental conditions: one-way ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)

    • For factorial designs testing multiple variables: two-way or multi-way ANOVA with interaction terms

Advanced Statistical Approaches:

Statistical MethodApplication in ugpA ResearchImplementation
Non-linear RegressionDetermining Km and Vmax from kinetic dataGraphPad Prism or R (nls package)
Mixed Effects ModelsAccounting for batch variation in transport assaysR (lme4 package)
Time Series AnalysisAnalyzing dynamic transport responses over timeR (forecast package)
Multivariate AnalysisCorrelating transport activity with multiple cellular parametersR (vegan or FactoMineR packages)

Experimental Design Considerations for Statistical Validity:

To ensure robust statistical analysis, researchers should:

  • Include sufficient biological replicates (minimum n=3, preferably n≥5)

  • Incorporate technical replicates within each biological replicate

  • Use randomization to minimize systematic errors

  • Include appropriate positive and negative controls

  • Perform power analysis to determine adequate sample sizes for detecting expected effect sizes

When reporting results, always include measures of variability (standard error or confidence intervals) and exact p-values rather than threshold statements (p<0.05), following current best practices in statistical reporting.

How should researchers interpret contradictory results regarding ugpA regulation and function?

When confronting contradictory results in ugpA research, researchers should follow a systematic framework for reconciliation and interpretation:

1. Evaluate Methodological Differences:
Begin by cataloging methodological variations between studies that yielded contradictory results:

  • Strain background (laboratory vs. clinical isolates)

  • Growth conditions (media composition, temperature, aeration)

  • Measurement techniques (direct transport assays vs. gene expression)

  • Time points of analysis (early vs. late growth phases)

2. Consider Context-Dependent Regulation:
The ugp transport system's regulation may be more complex than initially understood:

  • Hierarchical regulation involving multiple factors beyond phosphate limitation

  • Integration with other stress responses (carbon starvation, acid stress)

  • Strain-specific regulatory mechanisms in pathogenic vs. laboratory strains

  • Post-transcriptional regulatory mechanisms affecting protein levels or activity

3. Reconciliation Strategies for Contradictory Data:

Contradiction TypeReconciliation ApproachExample in ugpA Research
Opposite phenotypesIdentify strain-specific factorsE. coli O6:K15 may have unique regulatory elements affecting ugpA
Different kinetic parametersStandardize assay conditionspH, temperature, and ionic strength affect transport measurements
Varying gene expression patternsMeasure at multiple levels (RNA, protein, activity)Transcription may not correlate with protein levels due to post-transcriptional control
Inconsistent regulatory responsesMap comprehensive regulatory networksInteraction between Pho and other regulons may create condition-specific responses

4. Model Refinement:
Use contradictory data to develop more sophisticated models:

  • Incorporate feedback loops and threshold effects

  • Consider spatial/temporal dynamics of expression

  • Include stochastic elements to account for cell-to-cell variability

  • Develop mathematical models that can accommodate apparently contradictory observations under different conditions

By systematically applying these approaches, researchers can transform contradictory results from obstacles into opportunities for deeper understanding of ugpA regulation and function in E. coli O6:K15:H31.

What validation approaches confirm the physiological relevance of ugpA research findings?

Establishing the physiological relevance of ugpA research findings requires comprehensive validation across multiple experimental systems and conditions:

In Vitro to In Vivo Translation:

  • Correlation with Natural Environments:

    • Confirm ugpA expression in environmentally relevant phosphate concentrations

    • Verify transport activity in simulated host conditions (urine, intestinal fluid)

    • Determine if ugpA expression patterns match those observed during actual infection

  • Genetic Validation Approaches:

    • Perform complementation studies in ugpA mutants to confirm phenotype specificity

    • Create point mutations in chromosomal ugpA to maintain native expression levels

    • Use conditional expression systems to titrate ugpA levels and correlate with phenotypes

Validation in Infection Models:

Model SystemApplication to ugpA ResearchMeasured Outcomes
Tissue CultureAdherence and invasion of epithelial cellsQuantify bacterial attachment and internalization
Galleria mellonellaSimplified in vivo modelSurvival curves, bacterial burden
Mouse UTI ModelUrinary tract colonizationBacterial counts in bladder and kidneys
Mouse Intestinal ModelIntestinal colonizationCompetitive index with wild-type strain

Molecular Validation Techniques:

To confirm that observed phenotypes directly result from ugpA function:

  • Perform epistasis analysis with other transport system components

  • Use metabolomic approaches to track phosphate flow through cellular pathways

  • Implement Chromatin Immunoprecipitation (ChIP) to verify regulator binding in vivo

  • Apply ribosome profiling to assess translation efficiency of ugpA mRNA

Physiological Coherence Analysis:

Researchers should demonstrate that findings about ugpA align with broader physiological processes:

  • Show coordination between ugpA expression and related phosphate acquisition systems

  • Correlate ugpA activity with measurable phosphate-dependent cellular processes

  • Demonstrate that ugpA-mediated transport responds appropriately to physiological signals

These validation approaches collectively establish whether laboratory findings about the ugpA transport system reflect its authentic biological role in E. coli O6:K15:H31 pathophysiology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.