Recombinant Escherichia coli O6:K15:H31 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

General Information

Escherichia coli O6:K15:H31 is a strain of E. coli known for its pathogenicity, particularly in causing urinary tract infections . Within this strain, the spermidine export protein MdtJ (mdtJ) plays a role in managing intracellular spermidine levels . MdtJ functions as a component of a multidrug/spermidine efflux transporter, specifically as the integral membrane subunit of a heterodimeric complex with MdtI .

Synonyms

  • mdtJ

  • ECP_1544

  • Spermidine export protein MdtJ

  • MdtJI spermidine SMR transporter

Function

MdtJ catalyzes the excretion of spermidine, assisting in maintaining optimal levels of this polyamine within the cell .

Subcellular Location

MdtJ is located in the cell's inner membrane as a multi-pass membrane protein.

Role and Significance

Polyamines like spermidine are crucial for cell growth, and their levels are maintained through biosynthesis, degradation, uptake, and excretion . MdtJ is essential for cell recovery from the toxicity caused by excessive spermidine accumulation . The expression of mdtJI mRNA increases in response to spermidine, indicating a regulatory mechanism to control spermidine levels .

MdtJI Complex

MdtJ functions in conjunction with MdtI to form the MdtJI complex, which is a spermidine excretion protein complex . Both MdtJ and MdtI are required for the excretion activity, and the complex enhances cell viability and growth by excreting spermidine when it over-accumulates .

Genetic Context

The mdtJ and mdtI genes are located adjacent to each other on the chromosome and are cotranscribed . These genes encode components of a multidrug/spermidine/deoxycholate efflux transporter . Overexpression of mdtJI in a strain lacking the major multidrug efflux system AcrAB confers increased resistance to deoxycholate, nalidixic acid, fosfomycin, and SDS .

Pathogenicity Island Association

The E. coli O6:K15:H31 strain carries pathogenicity islands (PAIs), which are distinct DNA regions encoding virulence factors . The K15 capsule determinant, associated with uropathogenic E. coli strain 536 (O6:K15:H31), is part of a 79.6-kb pathogenicity island (PAI) designated PAI V536 . These PAIs contribute to the strain's ability to cause infections .

Research Applications

Recombinant MdtJ protein is used in research for studying spermidine transport and multidrug resistance mechanisms . It can be produced in vitro using E. coli expression systems .

Spermidine Transport

Transport SystemDescription
MdtJI ComplexEnhances the excretion of spermidine from cells, especially when spermidine levels are elevated . Requires both MdtJ and MdtI for activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mdtJ; ECP_1544; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links

KEGG: ecp:ECP_1544

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtJ protein and what is its primary function?

MdtJ is a membrane protein that functions together with MdtI to form the MdtJI complex in Escherichia coli. This complex belongs to the small multidrug resistance (SMR) family of drug exporters and primarily functions as a spermidine excretion system at neutral pH. Unlike previously identified polyamine transport systems in E. coli that function as importers or pH-dependent exporters, the MdtJI complex represents the first identified polyamine excretion system that functions effectively at neutral pH . Both MdtJ and MdtI are necessary for this function, as neither protein alone can effectively export spermidine .

What is the relationship between MdtJ and MdtI?

MdtJ and MdtI function together as a complex (MdtJI) to facilitate spermidine excretion. Experimental evidence demonstrates that both proteins are required for this function, as expression of either gene alone does not significantly increase cell viability in the presence of high spermidine concentrations . The genes for these proteins (mdtJ and mdtI) are coexpressed, further supporting their functional relationship . This obligate partnership between MdtJ and MdtI represents a common feature among small multidrug resistance family transporters, which often function as homo- or heterodimers.

What specific amino acid residues are critical for MdtJ function?

Detailed mutational analysis has identified several key amino acid residues in MdtJ that are essential for the spermidine excretion activity of the MdtJI complex. Specifically, Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ are involved in the excretion activity . Similarly, Glu5, Glu19, Asp60, Trp68, and Trp81 in MdtI also participate in this function. These residues likely contribute to substrate recognition, binding, or the conformational changes necessary for transport. The predominance of aromatic and charged residues suggests potential interactions with the positively charged spermidine molecule, which contains multiple amine groups.

How does spermidine influence mdtJI expression?

Research indicates that spermidine positively regulates the expression of the mdtJI genes. The level of mdtJI mRNA increases in the presence of spermidine , suggesting a feedback mechanism that enhances spermidine export capacity when cellular levels rise. This transcriptional response represents an important regulatory mechanism for maintaining polyamine homeostasis and preventing the toxic effects of spermidine accumulation. Further investigation of this regulatory mechanism could provide insights into the broader regulatory networks controlling polyamine metabolism in bacteria.

How can researchers assess MdtJI-mediated spermidine excretion experimentally?

Researchers can employ several complementary approaches to measure MdtJI-mediated spermidine excretion:

  • Cell viability assays: Transform spermidine acetyltransferase-deficient E. coli strains (e.g., E. coli CAG2242) with vectors expressing MdtJI, then culture in the presence of high spermidine concentrations (e.g., 2-12 mM). Measure viability by plating dilutions on suitable media and determining colony-forming units .

  • Intracellular polyamine content analysis: Culture cells with or without MdtJI expression in the presence of spermidine, extract cellular polyamines, and measure their concentrations using HPLC or other quantitative methods .

  • Radioisotope-based excretion assays: Preload cells with [14C]spermidine, wash to remove extracellular radioactivity, then measure the appearance of radioactivity in the medium over time .

These methods can be combined with site-directed mutagenesis to assess the functional importance of specific residues in MdtJ and MdtI.

What experimental controls are essential when studying MdtJ function?

When investigating MdtJ function, several controls are essential to ensure valid interpretation of results:

  • Empty vector controls: Cells transformed with empty vectors should be included to control for vector-specific effects.

  • Single gene expression controls: Express MdtJ or MdtI individually to demonstrate the requirement for both proteins.

  • Other transporter controls: Include cells expressing other drug transporters to demonstrate specificity of the MdtJI effect for spermidine.

  • Substrate specificity controls: Test effects on other polyamines (e.g., putrescine) to determine substrate specificity.

  • Growth condition controls: Evaluate effects under various pH and temperature conditions to understand environmental influences on MdtJI function.

The reported study properly implemented these controls, demonstrating that from 33 tested drug transporters, only MdtJI significantly enhanced cell viability in the presence of high spermidine concentrations .

How should experiments be designed to analyze MdtJI-mediated spermidine transport?

Effective experimental design for studying MdtJI-mediated spermidine transport should include:

Independent VariableDependent Variable (by condition)Calculations
Strain/PlasmidSpermidine Content (nmol/mg protein)% Reduction
Control+2mM Spermidine
E. coli CAG2242/pUC11910.548.2
E. coli CAG2242/pUC mdtJI10.217.3

This table design follows best practices for data presentation , with the independent variable (strain/plasmid) in the left column and the dependent variable (spermidine content) divided by experimental conditions. The rightmost column contains calculated values (percent reduction in spermidine accumulation), facilitating interpretation of the results.

How can researchers quantitatively assess the functional impact of mutations in MdtJ?

To quantitatively assess the functional impact of MdtJ mutations, researchers should employ a systematic approach that combines multiple assays:

  • Cell viability assays with mutant proteins, comparing survival rates at various spermidine concentrations to wild-type MdtJ

  • Spermidine excretion assays using radiolabeled substrates to directly measure transport activity

  • Protein expression analysis to ensure that observed functional defects aren't due to reduced protein levels

Data should be organized in comparative tables that clearly show:

MdtJ VariantCell Viability (%)Spermidine Excretion RateProtein Expression Level
Wild-type100100%100%
Y4A<1015%95%
W5A<1012%98%
E15A<1020%97%

This approach allows researchers to distinguish between mutations that affect protein stability versus those that specifically impact transport function.

How can researchers resolve contradictory findings between viability and transport assays?

When confronted with contradictory results between viability and direct transport measurements, researchers should consider several factors:

  • Transport-independent effects: Some mutations might affect cell viability through mechanisms unrelated to spermidine transport, such as protein misfolding or disruption of membrane integrity.

  • Threshold effects: The relationship between transport activity and cell viability may not be linear; a certain threshold of transport activity may be required for viability.

  • Compensatory mechanisms: Alternative transporters or metabolic pathways might be upregulated in response to certain mutations.

  • Technical limitations: Different assays have varying sensitivities and may be influenced by different experimental variables.

To resolve such contradictions, researchers should employ complementary approaches, including:

  • Dose-response studies with varying spermidine concentrations

  • Time-course experiments to detect temporal differences in responses

  • Additional controls with known transport inhibitors

  • Genetic approaches combining mutations in MdtJ with alterations in related pathways

What bioinformatic approaches can provide insights into MdtJ structure-function relationships?

Given the challenges of membrane protein crystallography, bioinformatic approaches offer valuable insights into MdtJ structure-function relationships:

  • Homology modeling based on related SMR family transporters with known structures

  • Evolutionary conservation analysis to identify functionally important residues:

    • Residues conserved across MdtJ homologs in diverse bacteria

    • Residues specifically conserved in polyamine transporters but not other SMR family members

  • Molecular dynamics simulations to predict:

    • Membrane positioning of MdtJ

    • Interactions between MdtJ and MdtI

    • Potential binding sites for spermidine

  • Coevolution analysis to identify residues that might interact within the protein complex

These computational approaches can guide experimental design by generating testable hypotheses about specific residues and structural features important for MdtJ function.

What are promising approaches for characterizing the MdtJI complex structure?

Determining the three-dimensional structure of the MdtJI complex would significantly advance understanding of its function. Promising approaches include:

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM have enabled structural determination of membrane proteins at near-atomic resolution. This approach could reveal the arrangement of MdtJ and MdtI within the complex and potential substrate binding sites.

  • X-ray crystallography with stabilizing antibodies or nanobodies: These can help stabilize the complex in a specific conformation suitable for crystallization.

  • Nuclear magnetic resonance (NMR) spectroscopy: While challenging for membrane proteins, advances in solid-state NMR and selective isotopic labeling strategies make this approach increasingly feasible.

  • Cross-linking studies coupled with mass spectrometry: This approach can identify interacting regions between MdtJ and MdtI, providing constraints for computational modeling.

Each of these methods has specific advantages and limitations, and a comprehensive structural characterization would likely benefit from combining multiple approaches.

How might MdtJ function be integrated with broader polyamine homeostasis networks?

Future research should explore how MdtJ-mediated spermidine export integrates with other aspects of polyamine metabolism and regulation:

  • Interplay between export and metabolic pathways: Investigate potential regulatory connections between MdtJI expression and enzymes involved in polyamine synthesis and catabolism.

  • Stress response integration: Examine how MdtJI-mediated export responds to various stress conditions known to affect polyamine metabolism.

  • Systems biology approaches: Apply transcriptomic, proteomic, and metabolomic analyses to cells with varying MdtJI expression levels to identify broader network effects.

  • Regulatory network mapping: Identify transcription factors and regulatory RNAs that control mdtJI expression and connect it to other cellular processes.

Understanding these broader network connections would provide context for the physiological role of MdtJI beyond its basic transport function and could reveal new approaches for manipulating polyamine metabolism in biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.