Recombinant Escherichia coli O6:K15:H31 Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
dsbD; ECP_4380; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-565
Protein Length
Full Length of Mature Protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNEASQPVSVPQQEQPTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFIMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDIWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGET HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP
Uniprot No.

Target Background

Function
DsbD is crucial for the formation of correct disulfide bonds in certain periplasmic proteins and for the assembly of periplasmic c-type cytochromes. It acts by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps.
Database Links

KEGG: ecp:ECP_4380

Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is DsbD and what is its primary function in E. coli?

DsbD is a membrane protein that functions as a central component of the disulfide bond formation system in E. coli. It maintains the redox balance in the bacterial periplasm by transferring electrons from cytoplasmic thioredoxin to various periplasmic substrates. Specifically, DsbD serves as an electron donor to several periplasmic thiol-disulfide oxidoreductases, including DsbC (the disulfide isomerase), DsbG (which protects single cysteines from oxidation), and DsbE (also known as CcmG, involved in cytochrome c maturation).

DsbD maintains DsbE in a reduced state, which is essential for the assembly of c-type cytochromes. DsbE catalyzes a late, reductive step in this assembly, likely by reducing disulfide bonds of the apocytochrome c to allow covalent linkage with the heme . Research focusing on this relationship should consider the interconnected nature of the Dsb system when designing experiments.

How should researchers prepare for working with E. coli strains expressing recombinant DsbD?

Methodologically, researchers should:

  • Verify the strain classification (K-12 derived vs. pathogenic)

  • Submit appropriate biosafety documentation

  • Prepare appropriate containment facilities

  • Design experimental controls including wild-type strains and negative controls

This preparatory phase is critical for both regulatory compliance and experimental validity when working with recombinant proteins such as DsbD.

What expression systems are most suitable for producing recombinant DsbD?

When expressing membrane proteins like DsbD, selection of an appropriate expression system is crucial. E. coli expression systems remain the most widely used for recombinant production of bacterial membrane proteins. For optimal expression of functional DsbD, consider the following methodological approach:

  • Vector selection: Use vectors with tunable promoters (such as pET series with T7 promoter)

  • Host strain selection: E. coli K-12 derivatives like BL21(DE3) are commonly used

  • Growth conditions: Optimize temperature, typically using lower temperatures (16-25°C) to slow expression and allow proper folding

  • Induction parameters: Use reduced concentrations of inducers like IPTG (0.1-0.5 mM)

For membrane proteins like DsbD, inclusion of fusion tags (such as His-tag) at either the N or C-terminus facilitates purification while maintaining protein functionality. Expression levels should be monitored using techniques such as Western blotting with specific antibodies against DsbD or the fusion tag.

What experimental design considerations are essential when studying DsbD-substrate interactions?

Studying DsbD-substrate interactions requires carefully designed experiments that account for the membrane-embedded nature of DsbD and the transient nature of its interactions. Based on established experimental design principles, researchers should implement:

Variable Control Strategy:

  • Independent Variables: DsbD expression levels, substrate concentrations, redox conditions

  • Dependent Variables: Interaction strength, functional outcomes, electron transfer rates

  • Control for Extraneous Variables: pH, temperature, ionic strength of buffers

A robust experimental design should include multiple methods to validate interactions:

TechniqueApplicationAdvantagesLimitations
Pull-down assaysPhysical interactionIdentifies stable complexesMay miss transient interactions
Surface Plasmon ResonanceBinding kineticsReal-time, label-freeRequires protein immobilization
FRET analysisProximity in live cellsWorks in native environmentRequires fluorescent tagging
Crosslinking studiesCapture of transient interactionsPreserves in vivo interactionsMay introduce artifacts

When formulating hypotheses about DsbD interactions, researchers should clearly define the null hypothesis (H0: "There is no interaction between DsbD and the substrate of interest") and the alternate hypothesis (H1: "DsbD forms a functional interaction with the substrate") . This framework ensures that experimental outcomes can be interpreted in context of the specific questions being addressed.

How can researchers troubleshoot issues in recombinant DsbD stability and functionality?

When working with membrane proteins like DsbD, researchers often encounter challenges with protein stability and functionality. A methodical troubleshooting approach should follow these steps:

  • Expression Optimization:

    • Test multiple expression temperatures (16°C, 25°C, 30°C, 37°C)

    • Vary inducer concentrations (0.01 mM to 1 mM IPTG)

    • Adjust expression duration (2h to overnight)

  • Stabilization Strategies:

    • Add specific lipids to mimic native membrane environment

    • Test various detergents for solubilization (DDM, LDAO, Triton X-100)

    • Include stabilizing agents (glycerol, specific ions, reducing agents)

  • Functionality Assessment:

    • Develop activity assays based on electron transfer capability

    • Use redox-sensitive dyes to track electron flow

    • Implement in vitro reconstitution of the DsbD-dependent pathways

If DsbD appears inactive, researchers should systematically assess:

  • Protein folding (circular dichroism spectroscopy)

  • Membrane insertion (protease accessibility assays)

  • Redox state of the cysteine residues (AMS labeling experiments)

Remember that membrane proteins often require their native lipid environment for full functionality, so consider techniques like nanodiscs or liposome reconstitution for functional studies.

What are the implications of studying DsbD in pathogenic E. coli strains like O6:K15:H31?

Studying DsbD in pathogenic E. coli strains such as O6:K15:H31 presents both opportunities and challenges. Researchers must be aware that:

  • All research involving pathogenic E. coli strains requires IBC approval and BSL-2 containment facilities before work can commence .

  • Pathogenic strains like O6:K15:H31 may exhibit different DsbD functionality compared to lab strains due to:

    • Variations in gene regulation

    • Differences in periplasmic substrate profiles

    • Potential roles in virulence factor maturation

When designing experiments with pathogenic strains, researchers should:

  • Compare DsbD function between pathogenic and non-pathogenic strains using identical methodologies

  • Assess whether DsbD contributes to virulence factor maturation through targeted mutagenesis

  • Investigate potential strain-specific interaction partners using comparative proteomics

A true experimental design would involve:

  • Control Group: K-12 laboratory strain expressing recombinant DsbD

  • Experimental Group: O6:K15:H31 strain expressing recombinant DsbD

  • Variable Manipulation: Systematic alteration of environmental conditions relevant to infection

This design helps isolate the strain-specific effects on DsbD function from other variables.

What purification strategies yield highest activity for recombinant DsbD?

Purification of membrane proteins like DsbD requires specialized approaches to maintain structural integrity and functionality. A methodological workflow should include:

  • Membrane Fraction Isolation:

    • Lyse cells using methods that preserve membrane integrity (French press or sonication)

    • Separate membrane fraction through ultracentrifugation (typically 100,000 × g for 1 hour)

  • Solubilization Optimization:

    • Test detergent panel (start with mild detergents like DDM or LMNG)

    • Optimize detergent:protein ratio (typically 10:1 to 20:1)

    • Include stabilizing agents (glycerol 10%, reducing agents like DTT or TCEP)

  • Chromatography Sequence:

    • Initial capture: IMAC for His-tagged proteins

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

For DsbD specifically, maintaining the correct redox state throughout purification is critical. Consider adding reducing agents like DTT (1-5 mM) to all buffers but be aware this may interfere with some purification methods.

Purification StepCritical ParametersQuality Control
Membrane isolationTemperature (4°C), Protease inhibitorsSDS-PAGE, Western blot
Detergent solubilizationDetergent type, concentration, timeSolubilization efficiency
IMACImidazole concentration gradientPurity assessment by SDS-PAGE
Size exclusionFlow rate, buffer compositionMonodispersity by dynamic light scattering

Successful purification should be verified by assessing both purity (>95% by SDS-PAGE) and functionality (electron transfer activity assays) .

How can researchers effectively measure DsbD-mediated electron transfer?

Measuring electron transfer mediated by DsbD requires specialized techniques that can detect redox changes. A comprehensive approach includes:

  • In vitro reconstitution assays:

    • Purified DsbD reconstituted in liposomes or nanodiscs

    • Addition of electron donor (reduced thioredoxin)

    • Addition of electron acceptor (oxidized DsbC, DsbG, or DsbE)

    • Monitoring redox state changes using thiol-reactive probes

  • Spectroscopic techniques:

    • Intrinsic tryptophan fluorescence changes upon redox changes

    • Circular dichroism to detect conformational changes during electron transfer

    • Stopped-flow kinetics to capture rapid electron transfer events

  • Genetic complementation assays:

    • Use of dsbD knockout strains with phenotypic defects

    • Complementation with wild-type or mutant DsbD variants

    • Quantification of restored function (e.g., cytochrome c maturation)

When designing these experiments, researchers should employ proper controls including:

  • Redox-inactive DsbD mutants (with key cysteine residues mutated)

  • Thioredoxin-independent electron sources

  • System-specific positive and negative controls

Quantification of electron transfer rates should employ multiple independent methods for verification and validation of observations.

How does DsbD interact with DsbE in the context of cytochrome c maturation?

The interaction between DsbD and DsbE (also known as CcmG) represents a critical junction in the cytochrome c maturation pathway. DsbD maintains DsbE in a reduced state, which is essential for the subsequent reduction of apocytochrome c disulfide bonds prior to heme attachment .

To study this interaction, researchers should consider:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of DsbD and DsbE

    • FRET analysis using fluorescently labeled proteins

    • Bacterial two-hybrid assays for in vivo verification

  • Functional coupling assays:

    • Monitor redox state of DsbE in presence/absence of functional DsbD

    • Assess cytochrome c maturation efficiency as a readout of the DsbD-DsbE electron transfer pathway

    • Use of thiol-reactive probes to track electron flow through the system

  • Structural studies:

    • Map interaction domains through targeted mutagenesis

    • Determine whether the interaction is transient or forms a stable complex

    • Identify key residues involved in electron transfer

DsbE belongs to the thioredoxin family (DsbE subfamily) , and this structural relationship provides insights into the mechanistic basis of the DsbD-DsbE interaction. The conserved CXXC motif in DsbE is critical for its function in accepting electrons from DsbD and subsequently transferring them to apocytochrome c.

What regulatory mechanisms control DsbD expression and activity in different E. coli strains?

The regulation of DsbD may vary between laboratory K-12 strains and pathogenic strains like O6:K15:H31. To investigate these differences, researchers should employ:

  • Transcriptional analysis:

    • qRT-PCR to quantify dsbD transcript levels under various conditions

    • Promoter-reporter fusions to visualize expression patterns

    • ChIP-seq to identify transcription factors regulating dsbD expression

  • Post-translational regulation studies:

    • Assess protein stability and turnover rates

    • Identify potential regulatory modifications (phosphorylation, etc.)

    • Determine impact of periplasmic stress on DsbD activity

  • Comparative genomics:

    • Analyze dsbD promoter regions across E. coli strains

    • Identify potential strain-specific regulatory elements

    • Determine conservation of potential regulatory proteins

When designing these experiments, researchers should consider true experimental design principles with:

  • Control Group: Standard laboratory conditions

  • Experimental Groups: Various stress conditions relevant to the bacterial lifecycle

  • Random Distribution: Sufficient biological replicates to account for variation

Proper randomization helps ensure that any observed differences in DsbD regulation between strains are attributable to genuine biological differences rather than experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.