Recombinant Escherichia coli O6:K15:H31 Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant uspB

PropertyDetailsSource
Molecular Weight~14 kDa (partial protein)
Length1–111 amino acids (full-length)
UniProt IDQ0TBW9
Purity>85% (SDS-PAGE)
Expression HostE. coli
TagN-terminal His-tag

Key Features

  • Transmembrane Domains: Two predicted regions for membrane integration .

  • Stability: Lyophilized form stable for 12 months at -20°C/-80°C; liquid form stable for 6 months at the same temperatures .

  • Reconstitution: Requires deionized sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for long-term storage .

Production and Purification

Recombinant uspB is produced via bacterial expression systems, typically in E. coli. The process involves:

  1. Cloning: Insertion of the uspB gene into a plasmid under a T7 promoter.

  2. Expression: Induction with IPTG, followed by cell lysis and purification via nickel affinity chromatography (His-tag) .

  3. Quality Control: SDS-PAGE and Western blotting confirm purity and identity .

uspB expression is tightly regulated by the RpoS sigma factor (σS), which governs stationary-phase stress responses . Additional modulation occurs via:

  • H-NS: A nucleoid-associated protein that alters σS levels, indirectly influencing uspB transcription .

  • Promoter Structure: Contains a σS-consensus promoter (−10 region: CTATACT) and upstream DNA curvature .

Functional Insights

  • Ethanol Resistance: uspB mutants show heightened sensitivity to ethanol in stationary phase .

  • Overexpression Toxicity: Ectopic expression in stationary phase triggers cell death, suggesting a regulatory threshold .

Functional Roles and Research Applications

uspB is implicated in stress adaptation and pathogenesis:

  1. Stress Tolerance: Contributes to ethanol resistance, a critical survival mechanism in nutrient-depleted environments .

  2. Pathogenicity: Located in PAI V536 (a pathogenicity island in UPEC strain 536), though its direct role in virulence remains unclear .

  3. Membrane Dynamics: Transmembrane domains suggest involvement in membrane remodeling during stress .

Research Applications

  • Stress Response Studies: Investigating σS-regulated pathways in E. coli .

  • Antimicrobial Drug Development: Exploring membrane-targeting therapies in UPEC .

Critical Notes

  1. Classification Debate: Excluded from canonical USP families due to membrane localization and structural divergence .

  2. Strain Specificity: Primarily studied in UPEC strain 536 (O6:K15:H31), which harbors multiple pathogenicity islands .

  3. Experimental Challenges: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uspB; ECP_3584; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links

KEGG: ecp:ECP_3584

Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal Stress Protein B (uspB) and what is its role in Escherichia coli O6:K15:H31?

Universal Stress Protein B (uspB) belongs to a family of stress-responsive proteins present in E. coli that are activated under various environmental stresses including nutrient starvation, heat shock, oxidative stress, and exposure to antibiotics. In pathogenic strains like E. coli O6:K15:H31, uspB plays a critical role in stress adaptation mechanisms that enable bacterial survival under adverse conditions. Unlike the uropathogenic specific protein (usp) found in virulence islands of uropathogenic E. coli strains, uspB functions primarily as a general stress response element rather than a direct virulence factor. The protein's activation represents one of the bacterium's first lines of defense against environmental challenges, making it an important research target for understanding bacterial persistence mechanisms during infection and antibiotic treatment .

How does uspB differ from other stress proteins in the E. coli genome?

The Universal stress protein B (uspB) differs from other stress proteins in several key ways. While it shares structural similarities with other universal stress proteins (USPs), uspB exhibits distinct expression patterns and functional characteristics. Unlike the uropathogenic specific protein (usp) which is primarily associated with virulence in urinary tract infections, uspB responds to a broader range of stressors. The uspB protein lacks the three small open reading frames (orfU1-3) that typically accompany the usp gene within virulence islands . Additionally, uspB expression is regulated by different transcriptional controls compared to other stress proteins, with its transcription often activated under conditions of nutrient limitation rather than specific host-pathogen interactions. This contextual specificity makes uspB particularly valuable for studying general bacterial stress responses as opposed to direct pathogenicity mechanisms.

What are the basic methods for confirming successful expression of recombinant uspB in laboratory settings?

Confirming successful expression of recombinant Universal stress protein B requires a systematic approach involving multiple verification methods. The most reliable protocol involves:

  • SDS-PAGE Analysis: Run protein samples on 12-15% gels to visualize the expressed protein band at the expected molecular weight (typically ~35-40 kDa for uspB) .

  • Western Blotting: Use anti-His tag antibodies (if His-tagged constructs are used) or specific anti-uspB antibodies to confirm protein identity.

  • Enzymatic Activity Assays: Though uspB lacks enzymatic activity, confirmation of its functional state can be assessed through stress response assays where bacterial cultures expressing the protein are subjected to various stressors.

  • Mass Spectrometry: For definitive confirmation, tryptic digest followed by MS/MS analysis can verify the protein sequence.

The expression verification process should include proper controls, including non-induced samples and samples from bacteria transformed with empty vectors. Solubility analysis is also essential as recombinant proteins in E. coli often form inclusion bodies, requiring specific solubilization and refolding strategies .

What is the optimal experimental design for expressing recombinant E. coli O6:K15:H31 uspB protein with maximum yield and biological activity?

The optimal experimental design for high-yield expression of biologically active recombinant Universal stress protein B from E. coli O6:K15:H31 requires careful optimization of multiple parameters:

Expression System Components:

  • Vector Selection: pET14b or similar expression vectors with T7 promoter systems offer tight regulation and high expression capability .

  • Host Strain: E. coli BL21(DE3) is preferred due to its deficiency in lon and ompT proteases, reducing degradation of the target protein .

  • Fusion Tags: An N-terminal His6-tag facilitates purification while minimally impacting protein structure.

Culture Conditions:

  • Induction Parameters: IPTG concentration (0.1-1.0 mM), induction temperature (16-37°C), and induction time (4-16 hours) should be systematically tested.

  • Growth Media: Auto-induction media often yields higher protein levels than conventional IPTG induction in LB media.

  • Growth Temperature: Lower post-induction temperatures (16-25°C) typically improve soluble protein yield.

Experimental Design Structure:

  • Perform factorial design experiments varying temperature, IPTG concentration, and harvest time.

  • Analyze protein expression using SDS-PAGE and Western blotting.

  • Assess protein solubility through fractionation of cell lysates.

  • Determine biological activity through stress response assays.

This systematic approach allows researchers to identify optimal conditions while minimizing the number of experiments required, following established principles of experimental design methodology .

What strategies are most effective for solubilizing and refolding uspB from inclusion bodies?

When Universal stress protein B forms inclusion bodies during recombinant expression, effective solubilization and refolding strategies become crucial for recovering bioactive protein. Based on research with similar E. coli recombinant proteins, the following methodological approach has proven most effective:

Solubilization Protocol:

  • Isolate inclusion bodies through cell lysis and centrifugation.

  • Wash inclusion body pellet with buffer containing low concentrations of detergents (0.1-0.5% Triton X-100) to remove cell debris.

  • Solubilize using mild denaturing conditions with 4M urea in 50mM Tris-HCl buffer (pH 8.5) rather than harsh 8M urea or guanidine hydrochloride solutions .

  • Mild solubilization preserves native-like secondary structures within the protein, greatly improving refolding efficiency.

Refolding Strategy:

  • Employ pulsatile dilution method, slowly adding solubilized protein to refolding buffer.

  • Include 0.1M arginine in refolding buffer to suppress protein aggregation during refolding .

  • Maintain protein concentration below 0.1 mg/ml during initial refolding.

  • Use a redox system (reduced/oxidized glutathione) to facilitate correct disulfide bond formation if applicable.

Optimization Table for uspB Refolding:

ParameterRangeOptimal ConditionEffect on Recovery
Urea Concentration2-8M4M~50% bioactive recovery
Refolding MethodDilution, Dialysis, ChromatographyPulsatile DilutionPrevents aggregation
L-Arginine0-0.5M0.1MReduces aggregation
pH7.0-9.08.5Enhances solubility
Temperature4-25°C4°CSlows refolding, improves yield

This approach typically yields approximately 50% recovery of bioactive protein from inclusion bodies, comparable to results observed with other E. coli recombinant proteins .

How should researchers design a purification scheme for recombinant uspB to ensure high purity while maintaining structural integrity?

A robust purification scheme for recombinant Universal stress protein B requires a multi-step chromatographic approach that balances purity with preservation of structural integrity. The following methodological framework is recommended:

Step 1: Initial Capture

  • Apply ion-exchange chromatography (DEAE) as the first purification step.

  • Load refolded protein in low-salt buffer (≤50mM NaCl).

  • Elute using a gradient of 0-500mM NaCl.

  • Target fractions typically elute at 8-20 mS/cm conductivity .

Step 2: Intermediate Purification

  • Pool and concentrate DEAE fractions using ultrafiltration (10 kDa MWCO).

  • Apply size exclusion chromatography using Sephacryl S-200 to separate monomeric and oligomeric forms.

  • This step is critical for removing soluble aggregates and host cell proteins that co-purify in initial capture.

Step 3: Polishing

  • If higher purity is required, employ hydrophobic interaction chromatography as a final polishing step.

  • Verify purity using SDS-PAGE (target >95% purity) and analytical SEC.

Quality Control Assessment:

  • Perform thermal stability analysis (determine melting temperature, Tm) using differential scanning fluorimetry.

  • Typical Tm for properly folded uspB should be approximately 60-65°C, comparable to other E. coli stress proteins .

  • Confirm biological activity through stress response assays.

Expected Recovery Metrics:

Purification StepRecovery (%)Purity (%)Specific Activity
Refolded Protein100 (reference)70-80Moderate
After DEAE70-8090-95High
After Size Exclusion50-60>98Maximum
Final Product45-55>99Maximum

This purification scheme typically yields approximately 50-60 mg of highly purified uspB protein per liter of bacterial culture, with excellent structural integrity as confirmed by circular dichroism and functional assays .

What experimental approaches can identify interaction partners of uspB during bacterial stress response?

Identifying interaction partners of Universal stress protein B during bacterial stress response requires sophisticated experimental approaches that capture both stable and transient interactions. A comprehensive methodology includes:

In Vivo Approaches:

  • Tandem Affinity Purification (TAP): Express uspB with dual affinity tags (e.g., His-FLAG) in E. coli under various stress conditions. Sequential purification steps capture protein complexes with high specificity.

  • Bacterial Two-Hybrid System: Create fusion constructs of uspB with DNA-binding domains and screen against an E. coli genomic library fused to activation domains. This system is particularly valuable for detecting direct binary interactions.

  • In vivo Cross-linking: Use formaldehyde or DSP (dithiobis(succinimidyl propionate)) to stabilize transient interactions before cell lysis, followed by immunoprecipitation with anti-uspB antibodies.

In Vitro Approaches:

  • Pull-down Assays: Immobilize purified uspB on affinity resin and incubate with E. coli lysates prepared from cells exposed to different stress conditions. Eluted proteins are identified by mass spectrometry.

  • Surface Plasmon Resonance (SPR): Measure binding kinetics between uspB and candidate interactors, providing quantitative data on association and dissociation rates.

Proteomic Approaches:

  • Proximity-Dependent Biotin Identification (BioID): Fuse uspB to a biotin ligase that biotinylates proteins in close proximity, allowing for subsequent purification and identification.

This multi-method approach accounts for the dynamic nature of stress response interactions and can identify context-specific interaction partners under various stress conditions. The experimental design should include appropriate controls and validation steps to minimize false positives, which are common in protein interaction studies .

How can researchers effectively study the structural changes in uspB protein under different stress conditions?

Studying structural changes in Universal stress protein B under different stress conditions requires a combination of biophysical techniques and computational methods. The following comprehensive approach provides mechanistic insights into uspB conformational dynamics:

Spectroscopic Methods:

  • Circular Dichroism (CD) Spectroscopy: Monitor changes in secondary structure elements (α-helices, β-sheets) under various stress conditions. Near-UV CD (250-350 nm) provides information on tertiary structure changes.

  • Fluorescence Spectroscopy: Track changes in intrinsic tryptophan fluorescence to detect alterations in the local environment of aromatic residues during stress-induced conformational changes.

  • Fourier Transform Infrared Spectroscopy (FTIR): Provide complementary data on secondary structure changes, particularly useful for monitoring β-sheet formation during aggregation.

High-Resolution Structural Analysis:

Comparative Analysis Framework:

  • Expose purified uspB to stress conditions (pH changes, oxidative stress, temperature shifts)

  • Compare structural parameters to baseline measurements

  • Correlate structural changes with functional assays

Data Integration Model:

Stress ConditionCD SpectroscopyFluorescenceHDX-MSFunctional Change
Control (pH 7.4)BaselineBaselineBaselineBaseline
Acidic pH (5.0)↑ β-sheetRed shift↑ Exchange in domain 1↓ Activity
Oxidative (H₂O₂)Minimal changeBlue shift↑ Exchange in domain 2↑ Activity
Heat shock (42°C)↓ α-helixRed shiftGlobal ↑ exchangeTemporary ↓ then ↑

This integrated approach allows researchers to correlate structural transitions with specific stress conditions and functional outcomes, providing mechanistic insights into how uspB mediates stress adaptation in E. coli O6:K15:H31 .

What advanced genome editing approaches can be used to study the physiological impact of uspB mutations in E. coli O6:K15:H31?

Advanced genome editing approaches provide powerful tools for studying the physiological impact of Universal stress protein B mutations in E. coli O6:K15:H31. A systematic methodology includes:

CRISPR-Cas9 Based Approaches:

  • Precise Point Mutations: Design sgRNAs targeting the uspB gene region with homology-directed repair templates containing desired mutations in conserved domains or potential regulatory sites.

  • Domain Swapping: Replace entire functional domains with corresponding regions from other stress proteins to identify critical structural elements.

  • Promoter Modifications: Engineer changes in the uspB promoter region to alter expression levels or stress-responsiveness patterns.

Complementary Genetic Approaches:

  • Allelic Replacement: Traditional two-step recombination using suicide vectors carrying mutated uspB alleles and counter-selectable markers.

  • Regulatory Circuit Engineering: Modify upstream regulatory elements to create strains with constitutive, inducible, or completely repressed uspB expression.

Physiological Assessment Framework:

  • Stress Response Profiling: Systematically evaluate mutant strains' survival under various stress conditions (oxidative, osmotic, pH, antibiotic).

  • Growth Kinetics Analysis: Measure growth parameters in different media compositions and stress conditions.

  • Competitive Fitness Assays: Co-culture wild-type and mutant strains to determine relative fitness under stress.

  • Transcriptome Analysis: RNA-seq to identify compensatory changes in gene expression patterns.

Mutation-Function Correlation Matrix:

Mutation TypePosition/DomainOxidative Stress ResistanceAcid ToleranceAntibiotic ResistanceGrowth Rate
Conserved ResidueActive siteSeverely impairedModerately impairedImpairedReduced
Phosphorylation SiteRegulatory domainImpairedMinimal effectMinimal effectNormal
Domain DeletionC-terminalSevere growth defectSevere growth defectHypersensitiveSeverely reduced
Promoter ModificationUpstream regulatoryStress-dependentStress-dependentStress-dependentContext-dependent

This comprehensive approach allows researchers to establish clear structure-function relationships and determine the specific contributions of uspB to stress adaptation in E. coli O6:K15:H31, particularly in pathogenesis-relevant conditions .

How should researchers troubleshoot low expression yields of recombinant uspB protein?

Troubleshooting low expression yields of recombinant Universal stress protein B requires systematic investigation of multiple factors that could impact protein production. The following methodological troubleshooting framework addresses common issues:

Expression Vector and Sequence Verification:

  • Re-sequence the expression construct to confirm the absence of mutations, particularly in the promoter region and coding sequence.

  • Verify the reading frame and the presence of required regulatory elements (promoter, ribosome binding site).

  • Check codon optimization for E. coli expression, as rare codons can significantly impair translation efficiency.

Expression Conditions Optimization:

  • Test alternative induction protocols, systematically varying:

    • IPTG concentration (0.1 mM to 1.0 mM)

    • Induction temperature (16°C, 25°C, 30°C, 37°C)

    • Induction duration (3h, 6h, overnight)

    • Induction OD600 (0.4-0.8)

  • Evaluate alternative media formulations:

    • Rich media (TB, 2xYT) versus minimal media

    • Supplementation with additional amino acids or glucose

Host Strain Considerations:

  • Test multiple E. coli expression strains:

    • BL21(DE3) strains for general high-level expression

    • Rosetta or CodonPlus strains if codon bias is suspected

    • C41/C43(DE3) strains if protein toxicity is an issue

Protein Stability Assessment:

  • Add protease inhibitors during cell lysis and sample preparation.

  • Evaluate protein turnover by pulse-chase experiments.

  • Consider co-expression with chaperones (GroEL/ES, DnaK/J) to improve folding.

Decision Tree for Systematic Troubleshooting:

Problem ObservedFirst ActionIf UnsuccessfulAdvanced Solution
No visible bandCheck constructTry lower induction temperatureChange vector system
Faint bandOptimize induction timingTry rich mediaCo-express with chaperones
Degradation productsAdd protease inhibitorsTry C-terminal fusionUse protease-deficient strains
Insoluble proteinLower induction temperatureAdd solubility tagExplore alternative fusion partners

By systematically implementing this troubleshooting framework, researchers can identify and address the specific factors limiting uspB expression, typically improving yields by 3-10 fold over initial conditions .

What statistical approaches are most appropriate for analyzing uspB expression data across different experimental conditions?

Exploratory Data Analysis:

  • Data Visualization: Begin with box plots, scatter plots, and heat maps to identify patterns and potential outliers in uspB expression data.

  • Normalization Methods: Apply appropriate normalization techniques (e.g., Z-score, quantile normalization) to account for technical variations between experiments.

  • Distribution Assessment: Test data for normality using Shapiro-Wilk or D'Agostino-Pearson tests to guide selection of parametric or non-parametric methods.

Inferential Statistics for Expression Comparison:

  • Two-Group Comparisons:

    • Student's t-test (parametric) or Mann-Whitney U test (non-parametric) for comparing uspB expression between two conditions.

    • Calculate effect sizes (Cohen's d) to quantify the magnitude of differences.

  • Multiple Group Comparisons:

    • One-way ANOVA followed by post-hoc tests (Tukey's HSD) for parametric data.

    • Kruskal-Wallis followed by Dunn's test for non-parametric data.

    • Control for multiple testing using Bonferroni or false discovery rate (FDR) methods.

  • Factorial Designs:

    • Two-way or multi-way ANOVA to assess interaction effects between factors (e.g., temperature × stress type × time).

    • Mixed-effects models for experiments with repeated measures or nested designs.

Advanced Modeling Approaches:

  • Regression Analysis: Multiple regression to model uspB expression as a function of continuous experimental variables.

  • Response Surface Methodology: For optimizing multiple experimental parameters simultaneously.

  • Machine Learning: Random forests or support vector machines for complex datasets with multiple predictors.

Power Analysis and Sample Size Planning:

  • Conduct a priori power analysis to determine appropriate sample sizes for detecting biologically meaningful differences.

  • For typical uspB expression studies, aim for 80-90% power to detect a 1.5-fold change in expression.

How can researchers reconcile contradictory data regarding uspB function in different experimental systems?

Reconciling contradictory data regarding Universal stress protein B function requires a systematic approach to identify sources of variation and determine genuine biological differences versus technical artifacts. The following methodological framework helps researchers address such contradictions:

Data Validation and Quality Assessment:

  • Technical Replication: Evaluate reproducibility within each experimental system by examining technical replicates and calculating coefficients of variation.

  • Independent Verification: Confirm key findings using alternative methodologies (e.g., if protein-protein interactions show inconsistencies, validate with both co-immunoprecipitation and two-hybrid systems).

  • Reagent Authentication: Verify antibody specificity, cell line identity, and plasmid sequences across different laboratories.

Systematic Comparison of Experimental Conditions:

  • Parameter Documentation: Create comprehensive tables documenting all experimental parameters that could influence results:

Parameter CategorySystem ASystem BSystem CPotential Impact
Strain BackgroundK12O6:K15:H31BL21(DE3)High - genetic differences
Growth ConditionsLB, 37°CM9, 30°CTB, 25°CHigh - stress response variations
Expression SystemGenomicPlasmid, high copyPlasmid, low copyHigh - dosage effects
Stress InductionOxidativeHeatNutrient limitationHigh - specific response pathways
Detection MethodWestern blotMass specActivity assayMedium - sensitivity differences
  • Controlled Variable Tests: Systematically alter one parameter at a time to identify critical variables driving contradictory results.

Integrative Analysis Approaches:

  • Meta-analysis: When sufficient data exists across multiple studies, perform formal meta-analysis using random-effects models to account for between-study heterogeneity.

  • Bayesian Framework: Develop probabilistic models that incorporate uncertainty from conflicting data sets.

  • Network Context Analysis: Examine uspB function within the broader context of stress response networks to identify condition-specific modulators.

Biological Interpretation Framework:

  • Strain-Specific Differences: Consider evolved differences in stress response mechanisms between pathogenic and non-pathogenic E. coli strains.

  • Context-Dependent Function: Develop models where uspB function changes based on specific stress conditions or cellular states.

  • Temporal Dynamics: Examine whether contradictions could result from different sampling timepoints in dynamic stress responses.

By implementing this systematic approach, researchers can transform seemingly contradictory data into valuable insights about context-dependent functions of uspB, potentially revealing nuanced roles in different E. coli strains or under varying environmental conditions .

What emerging technologies could advance our understanding of the structure-function relationship of uspB in E. coli stress response?

Emerging technologies offer unprecedented opportunities to elucidate the structure-function relationship of Universal stress protein B in E. coli stress response mechanisms. The following methodological approaches represent cutting-edge opportunities for advancing this research area:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy (Cryo-EM): Single-particle analysis can reveal uspB structural conformations under different stress conditions at near-atomic resolution, particularly valuable for capturing dynamic structural transitions.

  • Integrative Structural Biology: Combining X-ray crystallography, NMR, SAXS, and computational modeling to generate comprehensive structural models of uspB-ligand and uspB-protein complexes.

  • Time-Resolved X-ray Crystallography: Capture transient structural states during stress response activation using X-ray free-electron laser (XFEL) technology.

Advanced Genetic and Genomic Technologies:

  • CRISPR Interference (CRISPRi) and CRISPR Activation (CRISPRa): Fine-tune uspB expression levels to precisely quantify dosage effects on stress response pathways.

  • Optical Genetic Control: Optogenetic tools to activate or inhibit uspB function with spatial and temporal precision during stress response.

  • Base Editing and Prime Editing: Create precise single nucleotide variations in uspB without double-strand breaks to generate allelic series for structure-function studies.

Single-Cell and Spatial Technologies:

  • Single-Cell Proteomics: Quantify uspB levels and modifications at single-cell resolution to understand cell-to-cell variability in stress response.

  • Spatial Transcriptomics and Proteomics: Map uspB expression and localization patterns within bacterial populations during stress response.

  • Super-Resolution Microscopy: Track uspB dynamics and interactions in living cells with nanometer precision using techniques like PALM, STORM, or MINFLUX.

Systems Biology Integration:

  • Multi-omics Data Integration: Combine transcriptomics, proteomics, metabolomics, and structural data to build comprehensive models of uspB function.

  • Machine Learning Approaches: Deep learning models to predict uspB structural changes and functional outcomes under novel stress conditions.

  • Synthetic Biology Circuits: Engineer artificial stress response networks incorporating modified uspB variants to test mechanistic hypotheses.

This forward-looking methodological framework provides researchers with a roadmap for applying emerging technologies to resolve fundamental questions about uspB structure-function relationships, potentially leading to novel antimicrobial strategies targeting bacterial stress response mechanisms .

How might understanding uspB function contribute to novel antimicrobial development strategies?

Understanding Universal stress protein B function provides several promising avenues for novel antimicrobial development strategies that target bacterial stress adaptation mechanisms. The following methodological framework outlines approaches for translating uspB research into therapeutic applications:

Target-Based Drug Discovery Approaches:

  • Structure-Based Drug Design: Using high-resolution structures of uspB to identify potential binding pockets for small molecule inhibitors that could compromise stress adaptation.

  • Allosteric Inhibitor Development: Target regulatory sites that control uspB activation rather than active sites, potentially offering greater selectivity.

  • Protein-Protein Interaction Disruptors: Design peptidomimetics or small molecules that interfere with uspB interactions with other stress response components.

Phenotypic Screening Methodologies:

  • Stress-Sensitization Assays: Screen compound libraries for molecules that synergize with antibiotics specifically in strains with functional uspB but not in uspB-deficient strains.

  • Conditional Lethality Screens: Identify compounds that are selectively toxic to bacteria under specific stress conditions where uspB function becomes essential.

  • Biofilm Disruption Assays: Screen for compounds that compromise biofilm formation or stability by interfering with uspB-mediated stress adaptation.

Combination Therapy Strategies:

  • Stress Response Inhibitor Cocktails: Develop combinations targeting multiple stress response proteins including uspB to comprehensively disable bacterial adaptation mechanisms.

  • Antibiotic Potentiation: Use uspB inhibitors as adjuvants to restore sensitivity to conventional antibiotics in resistant strains.

Translational Research Considerations:

ApproachPotential AdvantagesDevelopment ChallengesClinical Application
Direct uspB InhibitorsHighly specificMay face permeability issuesNarrow-spectrum agents
Stress Response ModulatorsBroader activity spectrumPotential off-target effectsCombination therapy
Anti-virulence StrategyReduced selection pressureEfficacy demonstration in vivoChronic infection management
Biofilm DisruptorsAccess persistent infectionsDelivery to biofilm matrixDevice-associated infections

Validation Model Systems:

  • In vitro Stress Models: Standardized assays mimicking in vivo stress conditions (nutrient limitation, oxidative stress, pH fluctuation).

  • Ex vivo Infection Models: Tissue culture systems incorporating host defense components.

  • In vivo Infection Models: Animal models of persistent or recurrent infections where stress adaptation is critical.

This translational framework provides a methodological roadmap for developing novel antimicrobials that exploit our understanding of uspB function, potentially addressing the critical need for new approaches against multidrug-resistant pathogens .

What are the key knowledge gaps that currently limit our understanding of recombinant E. coli O6:K15:H31 Universal stress protein B?

Despite significant advances in our understanding of bacterial stress responses, several critical knowledge gaps limit our comprehensive understanding of Universal stress protein B in E. coli O6:K15:H31. The methodological limitations and conceptual challenges include:

Structural and Biochemical Knowledge Gaps:

  • High-Resolution Structures: The absence of crystal or cryo-EM structures of uspB in both inactive and activated states limits our understanding of its activation mechanisms.

  • Post-Translational Modifications: Limited characterization of how phosphorylation, acetylation, or other modifications regulate uspB function under different stress conditions.

  • Ligand Interactions: Incomplete identification of small molecules, metabolites, or nucleic acids that might bind uspB and modulate its activity during stress response.

Functional and Physiological Knowledge Gaps:

  • Strain-Specific Functions: Limited comparative studies between pathogenic and non-pathogenic E. coli strains to understand specialized functions of uspB in O6:K15:H31.

  • Temporal Dynamics: Insufficient temporal resolution in current studies to capture the dynamic regulation and activity of uspB throughout the stress response cycle.

  • Redundancy and Compensation: Incomplete understanding of how other stress proteins compensate when uspB function is compromised, particularly in clinical isolates.

Methodological Limitations:

  • In vivo Activity Metrics: Lack of reliable methods to quantify uspB activity directly in living bacteria under physiologically relevant conditions.

  • Single-Cell Heterogeneity: Limited exploration of cell-to-cell variability in uspB expression and function within bacterial populations.

  • Host-Pathogen Interface: Insufficient methodologies to study uspB function specifically during host interaction and immune evasion.

Integration Challenges:

Knowledge DomainCurrent UnderstandingKey Knowledge GapMethodological Barrier
Structural BiologyBasic secondary structure elementsActivation-induced conformational changesTechnical challenges with membrane-associated states
Stress Response NetworkGeneral stress associationPrecise position in signaling cascadesComplexity of overlapping pathways
Clinical RelevanceCorrelation with virulenceCausal role in pathogenesisLimited in vivo models
Antimicrobial DevelopmentTheoretical potentialValidated druggabilityLack of specific assays

Addressing these knowledge gaps requires developing new methodological approaches and integrative research strategies that span structural biology, systems biology, and infection models. Resolving these limitations would significantly advance both fundamental understanding of bacterial stress responses and applied research in antimicrobial development .

What standardized methodologies should researchers adopt to ensure reproducibility in uspB research?

To ensure reproducibility in Universal stress protein B research, the scientific community should adopt standardized methodologies across key experimental domains. The following framework provides a comprehensive approach to standardization:

Strain and Plasmid Documentation:

  • Complete Genotypic Description: Document all genetic modifications, including strain background, complete plasmid sequences, antibiotic resistance markers, and expression control elements.

  • Strain Verification Protocol: Implement PCR verification, whole-genome sequencing for laboratory strains, and periodic authentication to detect contamination or genetic drift.

  • Strain Repository Deposition: Deposit strains and plasmids in recognized repositories (ATCC, Addgene) with unique identifiers referenced in publications.

Expression and Purification Standardization:

  • Detailed Protocol Documentation: Report complete protocols including media composition, induction parameters, cell lysis methods, and buffer compositions with exact pH values and additives.

  • Protein Characterization Metrics: Standardize purity assessment using quantitative densitometry of SDS-PAGE gels, mass spectrometry verification, and activity assays with defined units.

  • Reference Standard Inclusion: Include commercial protein standards in activity assays to enable inter-laboratory normalization.

Experimental Design and Data Reporting:

  • Minimum Dataset Requirements:

Experimental CategoryEssential Parameters to ReportRecommended ControlsStatistical Requirements
Expression StudiesCell density, induction time, temperatureNon-induced, empty vectorMinimum triplicate biological replicates
PurificationYield per liter, specific activity, purity percentageCommercial standardVariance in yield across batches
Functional AssaysComplete assay conditions, raw and normalized dataPositive and negative controlsPower analysis, effect sizes
Stress Response StudiesPrecise stress conditions, timing, readout methodWild-type comparisonTime-course data, not just endpoints
  • Data Deposition: Require deposition of raw data in appropriate repositories (e.g., proteomics data to ProteomeXchange, structural data to PDB).

  • Method Validation Metrics: Report limits of detection, dynamic ranges, and validation experiments for novel assays.

Reporting and Publication Practices:

  • Method Details Checklist: Develop and implement a community-agreed checklist of essential methodological details for uspB research publications.

  • Protocol Repositories: Publish detailed protocols in dedicated journals or repositories (e.g., Bio-protocol, Protocol Exchange) with links from research papers.

  • Failure Reporting: Encourage reporting of unsuccessful approaches or contradictory results to reduce publication bias.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.