Recombinant Escherichia coli O6:K15:H31 UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Definition and Context

YebN is a member of the UPF0059 family, a group of uncharacterized membrane proteins conserved in Gram-negative bacteria. In pathogenic E. coli O6:K15:H31, YebN is encoded within genomic regions linked to pathogenicity islands (PAIs), which are horizontally acquired virulence determinants . The recombinant form is produced by cloning the yebN gene into expression systems (e.g., E. coli or baculovirus) to study its structure, localization, and function .

Gene Context

  • Genomic Location: In strain 536 (O6:K15:H31), yebN is situated near the K15 capsule locus on PAI V<sub>536</sub>, a pathogenicity island associated with urinary tract infections .

  • Operon Association: In nonpathogenic E. coli K-12, yebN is co-transcribed with grxC, secB, and gpsA, genes involved in redox regulation, protein secretion, and lipid biosynthesis .

Protein Features

PropertyDetail
Molecular Weight~16 kDa (predicted for native protein)
DomainsN-terminal transmembrane segment; C-terminal rhodanese-like domain
LocalizationInner membrane (predicted via UniTmp and OPM databases)
Expression SystemE. coli (e.g., strain BL21) or baculovirus
Recombinant TagsVaries by construct (e.g., His-tag, GST-tag)

Role in Membrane Biogenesis

  • Interaction with YidC: YebN homologs (e.g., YibN) physically interact with YidC, a membrane insertase critical for integrating α-helical membrane proteins .

  • Enhanced Substrate Insertion: Co-expression with YidC substrates (e.g., phage coat proteins, ATP synthase subunit c) increases their membrane integration efficiency in vitro .

Secretion and Virulence

  • Link to Secretion Systems: The K15 capsule locus near yebN in pathogenic strains includes genes for a general secretion pathway (e.g., kpsMT), suggesting YebN may facilitate extracellular polysaccharide transport .

  • Non-Essential but Regulatory: Knockout studies show yebN is non-essential but upregulated under stress (e.g., SecDF-YajC depletion), implying compensatory roles in membrane homeostasis .

Expression Systems

ParameterE. coli-Based Baculovirus-Based
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Yield0.1–1.0 mg/mL0.1–1.0 mg/mL
Stability6–12 months at -80°C6–12 months at -80°C
TaggingVariable (manufacturer-specific)Variable (manufacturer-specific)

Research Applications

  • Membrane Protein Interaction Studies: Used in pull-down assays to identify binding partners (e.g., YidC) .

  • Structural Analysis: Purified for crystallization or cryo-EM to resolve membrane protein architectures .

Unresolved Questions and Future Directions

  • Mechanistic Role: The exact biochemical function of YebN remains unknown. Hypotheses include lipid scrambling, substrate chaperoning, or stress response modulation .

  • Pathogenic Contribution: In O6:K15:H31, its proximity to virulence loci suggests a role in host-pathogen interactions, but direct evidence is lacking .

Comparative Analysis of Homologs

StrainYebN CharacteristicsKey Reference
E. coli O45:K1Recombinant YebN produced with partial sequence (UniProt: B7MBM7) Cusabio Product Sheet
E. coli K-12Nonpathogenic homolog linked to SecB and redox regulation PMID 16369539
E. coli O6:K15:H31Putative virulence-associated membrane proteinPMC 517556

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; yebN; ECP_1764; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
Likely functions as a manganese efflux pump.
Database Links

KEGG: ecp:ECP_1764

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Expression System Selection

Q: Which E. coli strain is most suitable for recombinant YebN expression?

A: For initial expression screening of YebN membrane protein, BL21(DE3) and derivatives of the K-12 lineage are recommended due to their well-characterized expression properties. BL21(DE3) offers several advantages for membrane protein expression including deficiency in the Lon protease (which degrades many foreign proteins) and the absence of the OmpT outer membrane protease that can degrade proteins during cell lysis . For membrane proteins that prove toxic, specialized strains like C41(DE3) and C43(DE3) may provide better results as they contain mutations in the lacUV5 promoter that reduce expression levels to more tolerable amounts for the cell .

Gene Cloning Strategy

Q: What is the recommended approach for cloning the yebN gene?

A: The appropriate cloning strategy should begin with primer design based on the genomic sequence of E. coli O6:K15:H31, incorporating appropriate restriction sites (similar to the approach used for ompF gene where BamHI and XhoI were utilized) . The suggested workflow includes:

  • Extract genomic DNA from E. coli O6:K15:H31 using a commercial bacterial DNA extraction kit

  • Design primers with appropriate restriction sites flanking the yebN coding sequence

  • Amplify the yebN gene using high-fidelity PCR

  • Clone the amplified product into a preliminary vector (such as pMD19-T Simple)

  • Confirm the sequence integrity through DNA sequencing

  • Subclone into an expression vector (pET-28a(+) or similar) using appropriate restriction enzymes

  • Transform into expression host and confirm by colony PCR and sequencing

Vector Selection Criteria

Q: What expression vector features are crucial for successful YebN expression?

A: For membrane protein expression like YebN, the vector should contain:

  • An inducible promoter system (such as T7) for controlled expression

  • Appropriate fusion tags that can enhance solubility and facilitate purification

  • Compatibility with secretion if periplasmic expression is desired

  • Option for low-level basal expression to minimize toxicity before induction

The pET vector system, particularly pET-28a(+), has proven effective for membrane protein expression as demonstrated with OmpF protein . This vector provides an N-terminal His-tag for purification and a T7 promoter for controlled expression.

Overcoming Toxicity Challenges

Q: How can toxicity issues be addressed when expressing YebN in E. coli?

A: Membrane protein expression often results in toxicity due to membrane disruption or interference with host cellular processes. Several strategies can mitigate this issue:

  • Employ strains specifically developed for toxic protein expression such as C41(DE3) and C43(DE3), which contain mutations in the lacUV5 promoter that reduce expression levels

  • Utilize secretion pathways to direct the protein to the periplasm or extracellular medium, reducing cytoplasmic accumulation

  • Control expression tightly using auto-induction methods rather than IPTG induction

  • Lower the cultivation temperature (16-20°C) during expression

  • Decrease inducer concentration to reduce expression rate

For YebN expression, the Sec-dependent pathway may be employed by fusing the protein to an appropriate leader peptide such as OmpA, OmpC, or OmpF signal sequences to facilitate translocation to the periplasm .

Protein Folding Optimization

Q: What approaches ensure proper folding of recombinant YebN protein?

A: Correct folding of membrane proteins is critical for their function and stability. The following approaches can enhance proper folding:

  • Periplasmic Expression: Direct YebN to the periplasm where the oxidative environment facilitates correct disulfide bond formation if present in the protein structure

  • Engineered Strains: Utilize E. coli strains with oxidative cytoplasmic environments if the protein contains disulfide bonds

  • Detergent Selection: During purification, select appropriate detergents (such as LDAO, used successfully for OmpF) that mimic the natural membrane environment

  • Refolding Protocols: If inclusion bodies form, implement stepwise refolding protocols using detergents and artificial lipid environments

  • Fusion Partners: Express YebN with solubility-enhancing fusion partners to improve folding kinetics

Expression and Purification Protocol

Q: What is the optimal protocol for expression and purification of YebN?

A: Based on successful approaches with other membrane proteins like OmpF, the following protocol is recommended:

  • Auto-induction Method: Employ auto-induction media for controlled expression, which has shown success with OmpF

  • Inclusion Body Processing: If YebN forms inclusion bodies, solubilize using denaturants (like urea) followed by refolding assisted by detergents

  • Affinity Purification: Purify using Ni²⁺-NTA affinity chromatography if a His-tag is incorporated

  • Detergent Exchange: Replace the solubilization detergent with a milder one suitable for functional studies

  • Size Exclusion: Apply size exclusion chromatography as a final purification step to obtain homogeneous protein preparation

For YebN, aiming for protein purity of at least 90% would be suitable for downstream applications, as this level of purity has been shown to be sufficient for immunogenicity studies with other recombinant proteins .

Confirmation of Proper Folding

Q: How can the structural integrity of purified YebN be assessed?

A: Several analytical methods are available to verify correct folding of membrane proteins:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements

  • Fluorescence Spectroscopy: Assesses tertiary structure through intrinsic tryptophan fluorescence

  • Size Exclusion Chromatography: Analyzes oligomeric state and homogeneity

  • Limited Proteolysis: Correctly folded proteins show resistance to proteolytic digestion at specific sites

  • Functional Assays: Develop specific assays based on the known or predicted function of YebN

Homology Analysis Significance

Q: What insights can homology analysis provide for YebN research?

A: Homology analysis of YebN across bacterial species can reveal:

  • Evolutionary conservation patterns that indicate functional importance

  • Identification of critical domains and residues

  • Prediction of functional roles based on conserved motifs

  • Potential as a target for broad-spectrum antimicrobial development

This approach proved valuable for OmpF, where homology analysis revealed high conservation (90-100% identity) among approximately half of E. coli (46.7%) and Shigella (52.8%) strains, suggesting potential as a universal vaccine candidate .

Immunogenicity Assessment

Q: How can the immunogenic potential of recombinant YebN be evaluated?

A: For immunogenic characterization of YebN, implement the following experimental approaches:

  • Animal Immunization: Immunize mice with purified recombinant YebN following an appropriate schedule with adjuvants

  • Antibody Titer Determination: Use indirect ELISA (iELISA) to measure specific antibody response against both purified protein and whole bacterial cells

  • Cross-Reactivity Testing: Evaluate antibody cross-reactivity against related strains and species

  • Opsonophagocytosis Assay: Determine if antibodies enhance bacterial killing by phagocytes

  • Challenge Studies: Assess protective efficacy through bacterial challenge in appropriate animal models

For OmpF, such studies revealed high antibody titers (1:240,000 against purified protein and 1:27,000 against whole cells) and moderate protection (40-60% survival) in challenge studies .

Epitope Mapping Methodology

Q: What methods can identify immunogenic epitopes in the YebN protein?

A: Several approaches can map epitopes in YebN membrane protein:

  • Peptide Scanning: Synthesize overlapping peptides spanning the YebN sequence to identify antibody-binding regions

  • Phage Display: Screen phage-displayed peptide libraries with anti-YebN antibodies

  • Structural Analysis: Use X-ray crystallography or NMR to identify surface-exposed regions

  • Computational Prediction: Apply immunoinformatics tools to predict potential epitopes

  • Mutational Analysis: Create point mutations in predicted epitopes to confirm their importance

Previous studies with OmpF have identified antigenic epitopes located on several extracellular loops, which could provide a model for epitope mapping in YebN .

Secretion Pathway Selection

Q: Which secretion pathway is most effective for YebN membrane protein expression?

A: For membrane proteins like YebN, two main secretion pathways can be considered:

  • Post-translational Sec-dependent Pathway: This can be achieved by fusing YebN to signal peptides like Lpp, OmpA, OmpC, OmpF, or PelB. This pathway is generally suitable for proteins that fold slowly .

  • Co-translational SRP Pathway: Employing signal sequences like that of DsbA can target YebN to the periplasm via the Signal Recognition Particle pathway. This route is particularly beneficial for membrane proteins as it prevents premature folding in the cytoplasm .

The selection between these pathways depends on the specific characteristics of YebN, particularly its hydrophobicity and folding kinetics. Testing both approaches in parallel is often the most effective strategy.

Inclusion Body Management

Q: When is inclusion body formation beneficial for YebN research, and how should it be managed?

A: Inclusion body (IB) formation results from an imbalance between protein aggregation and solubilization. For YebN research, this could be either advantageous or problematic:

When IBs are beneficial:

  • If YebN can be efficiently refolded in vitro

  • When high-level purification from cellular contaminants is desired

  • When the protein is toxic in its native form

Management strategies:

  • Adjust conditions to favor IB formation if desired (higher induction temperature, stronger induction)

  • For resolubilization, employ denaturants like urea followed by refolding with detergents such as LDAO that simulate the native membrane environment

  • Implement stepwise reduction of denaturant concentration with concomitant addition of appropriate detergents

  • Monitor refolding efficiency through activity assays or structural analysis

Low Expression Yield Resolution

Q: How can low expression yields of YebN be improved?

A: Low yields of membrane proteins like YebN are common and can be addressed through systematic optimization:

  • Expression Strain Screening: Test multiple E. coli strains including BL21(DE3), C41(DE3), C43(DE3) and K-12 derivatives

  • Induction Conditions: Optimize induction timing, temperature, and inducer concentration

  • Media Formulation: Test enriched media formulations and auto-induction systems

  • Codon Optimization: Analyze and optimize the codon usage of the yebN gene for E. coli expression

  • Fusion Tags: Evaluate different N- or C-terminal fusion partners for enhanced expression

  • Constructs Modification: Create truncated versions removing potential problematic regions

Disulfide Bond Formation

Q: How can proper disulfide bond formation be ensured for YebN protein?

A: If YebN contains disulfide bonds critical for its structure and function, several strategies can ensure their proper formation:

  • Periplasmic Expression: Direct the protein to the periplasm where the Dsb family enzymes naturally catalyze disulfide bond formation

  • Engineered Cytoplasmic Expression: Utilize specialized E. coli strains with mutations in the thioredoxin–thioredoxin reductase (trxB) and glutaredoxin–glutaredoxin reductase (gor) systems, creating an oxidative cytoplasmic environment

  • In vitro Refolding: If expressed as inclusion bodies, implement controlled oxidative refolding conditions during the solubilization process

  • Disulfide Isomerase Addition: Include protein disulfide isomerase in refolding buffers to catalyze correct disulfide formation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.