Recombinant Escherichia coli O6:K15:H31 UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; ECP_3087; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links

KEGG: ecp:ECP_3087

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant UPF0114 protein YqhA?

E. coli and yeast expression systems generally provide the highest yields and shortest turnaround times for UPF0114 protein YqhA production. When post-translational modifications are critical for correct protein folding or activity retention, expression in insect cells with baculovirus or mammalian cells may be preferable, though these systems typically yield lower quantities of protein .

The expression system selection should be guided by your specific research objectives:

Expression SystemAdvantagesDisadvantagesOptimal Application
E. coliHigh yield, rapid production, cost-effective, technically feasibleLacks post-translational modifications, potential inclusion body formationStructural studies, high-throughput screens
YeastPost-translational capabilities (O-linked glycosylation, phosphorylation, acetylation), cost-effectiveN-linked glycosylation patterns differ from higher eukaryotesApplications requiring basic PTMs
Insect/BaculovirusMore complex PTMs, proper protein foldingLower yield, longer production timeFunctional studies requiring native-like folding
Mammalian cellsFull spectrum of PTMs, native-like foldingLowest yield, highest cost, longest production timeApplications requiring authentic human PTMs

How does the selection of replication origin affect UPF0114 protein YqhA expression in E. coli?

The choice of replication origin significantly impacts recombinant protein expression levels. For UPF0114 protein YqhA expression in E. coli BL21, two commonly used origins with distinct copy numbers are p15A (approximately 10 copies/cell) and high-copy pMB1' (500-700 copies/cell) .

The replication origin influences protein yield through several mechanisms:

Experimental data indicates that the optimal replication origin depends on the specific promoter system and growth conditions. For instance, p15A origin combined with the trc promoter has demonstrated exceptional expression levels in E. coli when grown on glycerol as a carbon source .

What promoter systems provide optimal expression control for UPF0114 protein YqhA in E. coli?

Promoter selection is crucial for achieving desired expression levels of UPF0114 protein YqhA. Several promoter systems have been extensively evaluated for recombinant protein expression in E. coli, including P<sub>T7</sub>, P<sub>lac</sub>, P<sub>trc</sub>, and P<sub>araBAD</sub> .

PromoterInduction MethodExpression LevelControl PrecisionRecommendation
P<sub>T7</sub>IPTGVery highModerateHigh-yield applications, requires T7 RNA polymerase
P<sub>lac</sub>IPTGLow-moderateGoodApplications requiring moderate expression
P<sub>trc</sub>IPTGHighGoodBalance of high expression and tight control
P<sub>araBAD</sub>L-arabinoseModerateExcellentApplications requiring precise expression control

Research has demonstrated that the combination of promoter system and replication origin significantly affects expression outcomes. A combination of p15A origin with the trc promoter shows particularly promising results for high-level expression while maintaining cellular health .

How can researchers optimize culture conditions to maximize UPF0114 protein YqhA expression?

Optimizing culture conditions for UPF0114 protein YqhA expression requires systematic evaluation of multiple parameters:

  • Carbon source selection: Glycerol often provides superior expression levels compared to glucose for E. coli expression systems, likely due to reduced catabolite repression. Experimental evidence shows significantly higher YFP reporter protein expression (used as a model for recombinant protein expression) in E. coli grown on glycerol compared to glucose under identical induction conditions .

  • Metabolic engineering approaches: Targeted genetic modifications can enhance production capacity. For instance, deleting the acetate kinase gene (ΔackA) has been shown to reduce acetate production and potentially improve recombinant protein yields in some expression systems .

  • Induction parameters: Optimize inducer concentration (typically 0.1 mM IPTG for lac-based promoters or 2 mM L-arabinose for araBAD promoter), induction timing (typically at mid-log phase), and temperature post-induction (often reduced to 25-30°C to improve protein folding) .

The following methodology is recommended for systematic optimization:

  • Begin with small-scale cultures (25-50 mL) testing combinations of:

    • Expression vectors (varying promoters and origins)

    • E. coli strains (wild-type vs. metabolically engineered)

    • Carbon sources (glucose vs. glycerol)

    • Induction conditions (concentration, OD at induction, temperature)

  • Quantify expression using fluorescence (if using reporter fusion), SDS-PAGE densitometry, or Western blot analysis

  • Scale up production using optimal conditions identified in preliminary experiments

What purification strategies should be employed for UPF0114 protein YqhA to ensure structural integrity?

Purification of UPF0114 protein YqhA requires a thoughtful approach that preserves structural integrity while achieving high purity. While the search results don't provide specific purification protocols for YqhA, general methodological principles for recombinant proteins with similar characteristics should be applied:

  • Affinity tag selection: For UPF0114 protein YqhA, common fusion tags include:

    • His<sub>6</sub> tag for IMAC purification (minimal impact on structure)

    • GST tag for glutathione affinity (enhances solubility)

    • MBP tag for maltose affinity (significantly improves solubility)

  • Cell lysis optimization: Gentle lysis methods should be employed to preserve native structure:

    • Enzymatic lysis with lysozyme (0.2-1 mg/mL) in combination with freeze-thaw cycles

    • Sonication with short pulses (10 seconds on/50 seconds off) to minimize heat denaturation

    • For membrane-associated proteins, use mild detergents (0.5-1% NP-40 or Triton X-100)

  • Multi-step purification strategy:

    • Initial capture step using affinity chromatography

    • Intermediate purification using ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Buffer optimization: Screen multiple buffer conditions for optimal stability:

    • pH range (typically 6.5-8.0)

    • Salt concentration (typically 100-500 mM NaCl)

    • Addition of stabilizing agents (5-10% glycerol, 1-5 mM reducing agents)

How should researchers design experiments to study O6:K15:H31 capsular polysaccharide interactions with UPF0114 protein YqhA?

Studying interactions between E. coli O6:K15:H31 capsular polysaccharide and UPF0114 protein YqhA requires careful experimental design. The K15 capsular polysaccharide has a repeating structure consisting of 4)-α-Glc<i>p</i>NAc-(1 → 5)-α-KDO<i>p</i>-(2 → that is partially <i>O</i>-acetylated at the 3-hydroxyl of GlcNAc .

A comprehensive experimental approach would include:

  • Capsular polysaccharide isolation and characterization:

    • Isolate K15 polysaccharide using established protocols for acidic capsules

    • Confirm structural identity using NMR spectroscopy and chemical analysis techniques

    • Characterize O-acetylation patterns quantitatively

  • Protein-polysaccharide interaction assays:

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Pull-down assays with immobilized polysaccharide to confirm direct interactions

  • Structural analysis of complexes:

    • X-ray crystallography of YqhA-polysaccharide complexes

    • Cryo-electron microscopy for larger assemblies

    • NMR spectroscopy for dynamic interaction mapping

  • Functional studies:

    • Site-directed mutagenesis of potential binding residues in YqhA

    • Competition assays with synthesized polysaccharide fragments

    • In vivo studies comparing wild-type and YqhA-deficient strains

What proteomics approaches are most effective for identifying UPF0114 protein YqhA interactions in a complex cellular environment?

Mass spectrometry-based proteomics offers powerful approaches for identifying UPF0114 protein YqhA interactions in complex cellular environments. Several methodologies can be employed:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged YqhA in E. coli O6:K15:H31

    • Perform gentle cell lysis to preserve protein-protein interactions

    • Capture protein complexes via affinity purification

    • Identify interacting partners by LC-MS/MS

    • Distinguish true interactions from background using quantitative approaches (SILAC, TMT labeling)

  • Proximity-dependent biotinylation (BioID/TurboID):

    • Generate fusion of YqhA with a promiscuous biotin ligase

    • Express in native environment and activate with biotin

    • Capture biotinylated proteins (proximity partners)

    • Identify by LC-MS/MS

    • This method captures transient and weak interactions that may be lost in AP-MS

  • Cross-linking mass spectrometry (XL-MS):

    • Treat live cells with membrane-permeable crosslinkers

    • Isolate YqhA and crosslinked partners

    • Perform tryptic digestion and identify crosslinked peptides by MS

    • This provides structural information about interaction interfaces

  • Data analysis with specialized tools:

    • Use Proteo Visualizer Cytoscape app to retrieve protein interaction networks from STRING database using protein groups as input

    • Apply network analysis to identify functional clusters

    • Calculate confidence scores for protein interactions

When reporting protein groups from MS data, researchers should consider implications of identification strategies:

  • "Majority Protein IDs" (most common in literature)

  • "Leading Proteins" (proteins with highest number of peptides)

  • Multiple accessions in case of ties

How can researchers distinguish between UPF0114 protein YqhA and similar proteins in proteomics studies?

Distinguishing UPF0114 protein YqhA from similar proteins in proteomics studies presents significant challenges due to sequence similarities and peptide sharing. To address this challenge:

  • Employ strategic peptide selection:

    • Identify unique peptides (not shared with other proteins) for YqhA identification

    • Target longer peptides (>10 amino acids) which are more likely to be unique

    • Consider post-translational modifications that may be specific to YqhA

  • Apply advanced mass spectrometry techniques:

    • Use high-resolution instruments (Orbitrap, timsTOF) for improved mass accuracy

    • Implement parallel reaction monitoring (PRM) for targeted quantification of specific YqhA peptides

    • Employ data-independent acquisition (DIA) for comprehensive peptide coverage

  • Implement sophisticated data analysis:

    • Use protein inference algorithms that correctly assign shared peptides

    • Recognize that proteins with similar sequences may be reported in protein groups

    • Understand that selecting only one gene per group affects network analysis results

  • Consider the impact of protein group handling:

    • Different accessions in the same protein group usually have similar sequences but may not share the same functional Gene Ontology (GO) annotations

    • GO-term enrichment is relatively robust when analyzing global proteomics datasets

    • Network generation is strongly impacted by which single gene is selected from a protein group

What computational tools are most appropriate for analyzing UPF0114 protein YqhA function in the context of E. coli O6:K15:H31 pathogenesis?

Advanced computational analysis of UPF0114 protein YqhA function requires specialized tools to integrate structural, genomic, and interaction data:

  • Protein-protein interaction network analysis:

    • Utilize the Cytoscape app Proteo Visualizer (https://apps.cytoscape.org/apps/ProteoVisualizer) to retrieve interaction networks from STRING database using protein groups as input

    • Calculate edge scores by summing all existing edges and dividing by the number of possible edges that could connect protein groups

    • Apply network visualization techniques that highlight protein groups with dashed edge lines when confidence scores fall below specified cutoffs

  • Gene Ontology (GO) enrichment analysis:

    • Calculate information content for each term t as ic(t) = -log(p(t)), where p(t) = freq(t)/freq(root)

    • Determine remaining uncertainty (ru) and missing information (mi) for protein pairs using established formulas

    • Recognize that collapsing protein groups requires aggregating numeric attributes like COMPARTMENTS and TISSUES confidence scores

  • Comparative genomics approaches:

    • Analyze gene neighborhood conservation across pathogenic E. coli strains

    • Examine gene cluster organization related to capsule biosynthesis

    • Identify potential functional partners encoded in the same operon

  • Structure-function prediction:

    • Employ homology modeling if crystallographic data is unavailable

    • Use molecular dynamics simulations to predict functional motions

    • Apply machine learning approaches to predict protein-polysaccharide binding sites

What are the most common challenges in expressing UPF0114 protein YqhA in E. coli, and how can they be addressed?

Recombinant expression of UPF0114 protein YqhA in E. coli faces several challenges that require systematic troubleshooting approaches:

  • Inclusion body formation:

    • Problem: Overexpressed YqhA may aggregate into insoluble inclusion bodies

    • Solution strategies:

      • Reduce expression temperature to 16-25°C after induction

      • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

      • Fuse YqhA with solubility-enhancing tags (MBP, SUMO, TrxA)

      • Optimize inducer concentration for slower expression

  • Metabolic burden and growth inhibition:

    • Problem: High-level expression can deplete cellular resources and inhibit growth

    • Solution strategies:

      • Use lower copy number plasmids (p15A origin) for balanced expression

      • Employ auto-induction media for gradual protein expression

      • Consider E. coli strains with enhanced metabolic capacity

      • Implement fed-batch cultivation to control growth rate

  • Inefficient translocation/transport:

    • Problem: Inefficient export of YqhA to proper cellular compartment

    • Solution strategies:

      • Optimize signal peptides if targeting to periplasm or membrane

      • Consider co-expression of translocation machinery components

      • Use E. coli strains with enhanced secretory capacity

  • Post-translational modification requirements:

    • Problem: E. coli lacks eukaryotic PTM machinery that may be required for full activity

    • Solution strategies:

      • If PTMs are essential, consider yeast expression for basic modifications

      • For complex PTMs, insect or mammalian expression systems may be necessary

      • Evaluate functional assays to determine if PTMs are required for your specific application

How can researchers resolve contradictory data from different expression systems when studying UPF0114 protein YqhA?

Resolving contradictory data from different expression systems requires systematic investigation and data integration:

  • Characterize protein products from each system:

    • Perform mass spectrometry analysis to confirm protein identity and detect PTMs

    • Use circular dichroism spectroscopy to compare secondary structure profiles

    • Conduct thermal shift assays to evaluate structural stability

    • Compare enzymatic or binding activity using standardized assays

  • Identify system-specific variables:

    • Document differences in codon usage optimization across expression systems

    • Characterize the presence and nature of fusion tags and their potential impact

    • Analyze growth conditions and induction parameters for each system

    • Consider host cell stress responses that may affect protein quality

  • Design validation experiments:

    • Express protein in multiple systems under standardized conditions

    • Perform parallel purification using identical protocols

    • Conduct side-by-side functional comparisons

    • Use orthogonal techniques to confirm contradictory findings

  • Statistical approach to data integration:

    • Apply meta-analysis techniques to evaluate data consistency across systems

    • Consider Bayesian approaches to update confidence in specific results

    • Implement principal component analysis to identify variables driving observed differences

    • Report all experimental conditions thoroughly to enable reproduction by other researchers

What strategies can resolve inconsistencies between structural predictions and experimental data for UPF0114 protein YqhA?

Resolving inconsistencies between computational predictions and experimental data for UPF0114 protein YqhA structure requires a methodical approach:

  • Evaluate prediction methodologies:

    • Assess the confidence scores of structure prediction algorithms

    • Consider template quality and coverage in homology modeling

    • Review force field parameters used in molecular dynamics simulations

    • Compare results from multiple prediction methods (AlphaFold, RoseTTAFold, I-TASSER)

  • Critical assessment of experimental data:

    • Evaluate resolution and quality metrics of crystallographic data

    • Consider dynamic regions that may adopt multiple conformations

    • Assess experimental conditions that might influence structural features

    • Review sample purity and potential for oligomerization or aggregation

  • Targeted validation experiments:

    • Design site-directed mutagenesis to test key structural predictions

    • Use hydrogen-deuterium exchange mass spectrometry to probe structural dynamics

    • Employ small-angle X-ray scattering (SAXS) to assess solution structure

    • Consider nuclear magnetic resonance (NMR) for regions with conformational flexibility

  • Integrate computational and experimental approaches:

    • Refine computational models using experimental constraints

    • Employ molecular dynamics simulations to explain experimental observations

    • Use enhanced sampling techniques to explore conformational landscapes

    • Develop ensemble models that may better represent the protein's native state

How might advanced gene editing technologies enhance the study of UPF0114 protein YqhA in E. coli O6:K15:H31?

Advanced gene editing technologies offer transformative approaches for investigating UPF0114 protein YqhA function:

  • CRISPR-Cas9 genome editing applications:

    • Generate precise yqhA knockout strains without polar effects

    • Create point mutations to test specific functional hypotheses

    • Implement CRISPRi for conditional knockdown to study essential functions

    • Establish CRISPR activation systems to upregulate native expression

  • High-throughput mutagenesis approaches:

    • Employ saturation mutagenesis to comprehensively map functional residues

    • Implement deep mutational scanning coupled with functional selection

    • Create domain swap chimeras with related proteins to identify functional domains

    • Generate tagged variants for subcellular localization studies

  • Synthetic biology strategies:

    • Reconstitute potential YqhA-containing pathways in non-pathogenic chassis

    • Create synthetic genetic circuits to control YqhA expression dynamically

    • Implement optogenetic or chemogenetic control systems for temporal regulation

    • Design minimal expression systems to study YqhA function in isolation

  • Integration with systems biology:

    • Combine genomic, transcriptomic, and proteomic data to model YqhA function

    • Apply flux balance analysis to understand metabolic impacts of YqhA modulation

    • Implement genome-scale models to predict phenotypic consequences of YqhA alterations

    • Use multi-omics approaches to map the regulatory network surrounding YqhA

What novel methodologies could advance our understanding of the role of UPF0114 protein YqhA in pathogenic E. coli strains?

Emerging methodologies offer new avenues for investigating UPF0114 protein YqhA's role in pathogenesis:

  • Single-cell approaches:

    • Apply single-cell proteomics to study YqhA expression heterogeneity

    • Implement microfluidic systems to track individual cell responses

    • Use time-lapse microscopy with fluorescent reporters to monitor dynamic YqhA localization

    • Employ single-cell RNA-sequencing to correlate YqhA expression with global transcriptional changes

  • Cryo-electron tomography:

    • Visualize YqhA in its native cellular context at molecular resolution

    • Map interactions with cellular structures and potential binding partners

    • Study the structural impact of YqhA on capsular polysaccharide organization

    • Examine YqhA distribution during different growth phases and stress conditions

  • Host-pathogen interaction models:

    • Develop organoid infection models to study YqhA's role in pathogenesis

    • Implement tissue-on-chip technologies for controlled host-pathogen interactions

    • Use humanized mouse models to study YqhA function during infection

    • Apply dual RNA-seq to simultaneously track host and pathogen responses

  • Structural interactomics:

    • Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein interaction surfaces

    • Implement integrative structural biology combining multiple data types

    • Use cross-linking mass spectrometry to capture transient interactions

    • Develop computational models of YqhA-containing protein complexes

How might proteogenomic approaches enhance our understanding of UPF0114 protein YqhA function?

Proteogenomic integration offers powerful approaches for elucidating UPF0114 protein YqhA function:

  • Custom database approaches:

    • Generate strain-specific protein databases that account for genomic variations

    • Include potential alternative start sites, splice variants, and processed forms

    • Incorporate predicted post-translational modifications

    • Apply specialized search algorithms to identify novel proteoforms

  • Multi-omics data integration:

    • Correlate YqhA protein abundance with transcriptional and translational efficiency

    • Map quantitative trait loci (QTLs) that influence YqhA expression or function

    • Identify co-regulated genes and proteins that may function in common pathways

    • Develop predictive models of YqhA's role in cellular networks

  • Evolutionary proteomics:

    • Compare YqhA sequence and structure across pathogenic and non-pathogenic strains

    • Identify conservation patterns that suggest functional constraints

    • Detect signatures of positive selection that may indicate host adaptation

    • Reconstruct the evolutionary history of YqhA and related UPF0114 family proteins

  • Functional annotation refinement:

    • Apply systematic phenotypic profiling of YqhA variants

    • Implement high-throughput assays to test predicted functions

    • Use comparative genomics to transfer functional annotations from characterized orthologs

    • Develop machine learning approaches to predict functional associations based on proteogenomic features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.