Recombinant Escherichia coli O6:K15:H31 UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
yfbV; ECP_2334; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: ecp:ECP_2334

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YfbV protein in Escherichia coli?

YfbV is a membrane protein classified as UPF0208 (Uncharacterized Protein Family 0208) found in Escherichia coli. It is a 151-amino acid protein encoded by the yfbV gene that appears to be conserved across various E. coli strains, including pathogenic variants such as O6:K15:H31 . While its precise biological function remains incompletely characterized, YfbV is known to be a membrane-associated protein that may contribute to bacterial virulence. The protein has been studied in multiple E. coli strains including E. coli ED1a, where computational modeling has provided insights into its structure with a global pLDDT (predicted Local Distance Difference Test) confidence score of 81.8, indicating a relatively reliable structural prediction .

How is YfbV related to pathogenicity in E. coli strains?

YfbV appears to be associated with pathogenic E. coli strains, particularly E. coli O6:K15:H31 strain 536, which contains multiple pathogenicity islands (PAIs) . While the direct contribution of YfbV to pathogenicity isn't explicitly detailed in the search results, the gene is found in the context of pathogenic strains containing virulence factors. E. coli strain 536 (O6:K15:H31) has been established as a model organism for studying extraintestinal pathogenic E. coli (ExPEC) and contains at least four pathogenicity islands (PAI I536 to PAI IV536) ranging from 68 to 102 kb in size . These PAIs exhibit characteristic features including:

  • Association with tRNA-encoding genes

  • G+C content differing from the host genome

  • Flanking repeat structures

  • Mosaic-like structure with multiple functional and non-functional open reading frames

  • Presence of mobile genetic elements

The K15 serotype specifically has been identified in both enterotoxigenic and uropathogenic E. coli strains, frequently occurring together with the O6 antigen . This suggests that YfbV may play a role in the pathogenicity mechanisms of these strains, though its specific function requires further investigation.

What expression systems are optimal for producing recombinant YfbV protein?

The optimal expression system for recombinant YfbV protein production depends on research objectives, required protein yields, and downstream applications. Based on available information, several expression systems have been used successfully:

  • E. coli expression systems: These are most commonly used due to their high yield, ease of manipulation, and cost-effectiveness. When expressing membrane proteins like YfbV, E. coli BL21(DE3) or its derivatives are frequently employed with specific considerations for membrane protein expression .

  • Yeast expression systems: Mentioned as a potential source for recombinant YfbV protein production, offering eukaryotic post-translational modifications .

  • Baculovirus expression systems: Can provide higher levels of properly folded membrane proteins compared to bacterial systems .

  • Mammalian cell expression systems: Offer the most authentic post-translational modifications but typically with lower yields .

For optimal expression of membrane proteins like YfbV, several factors should be considered:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coliHigh yield, inexpensive, rapid growthLimited post-translational modifications, inclusion body formationStructural studies, antibody production
YeastEukaryotic processing, moderate yieldLonger expression time, different glycosylationFunctional studies requiring eukaryotic modifications
BaculovirusHigher-quality membrane protein folding, high yieldComplex setup, longer production timeStructural studies of complex membrane proteins
Mammalian cellsNative-like modifications, proper foldingLower yields, expensive, time-consumingFunctional studies requiring authentic modifications

When using E. coli systems, experimental design approaches like those described for recombinant pneumolysin (rPly) can be adapted for YfbV expression, where variables such as medium composition (yeast extract, tryptone, glucose, glycerol concentrations), induction conditions (inducer concentration, induction timing), and growth conditions (temperature) are optimized using multivariant analysis to maximize soluble protein expression .

How can multivariate analysis improve YfbV protein expression in E. coli?

Multivariate analysis offers significant advantages over traditional univariate approaches for optimizing recombinant protein expression, including YfbV. Implementing a systematic experimental design methodology allows researchers to:

  • Evaluate multiple variables simultaneously, capturing interactions between factors that affect expression

  • Characterize experimental error systematically

  • Compare normalized effects between variables

  • Gather high-quality information with fewer experiments

For YfbV expression optimization, researchers can employ fractional factorial design to evaluate key variables that influence protein production:

VariableRange to TestRationale
Yeast extract concentration0.5-1.5%Provides nutrients and cofactors
Tryptone concentration0.5-2.0%Amino acid source
Glucose concentration0-0.4%Carbon source, may repress expression
Glycerol concentration0-0.8%Alternative carbon source
Antibiotic concentration30-50 μg/mLMaintains plasmid stability
Inducer concentration0.1-1.0 mMControls expression level
OD600 at induction0.4-1.0Cell density affects expression efficiency
Post-induction temperature16-37°CAffects protein folding and solubility

This approach has demonstrated success in achieving high yields (250 mg/L) of soluble recombinant protein in E. coli with maintained functional activity, as shown with recombinant pneumolysin . A similar methodology could be applied to optimize YfbV expression.

The statistical analysis should:

  • Identify statistically significant variables

  • Quantify interactions between variables

  • Determine optimal conditions for maximum soluble expression

  • Validate findings with confirmation runs

This multivariate approach is particularly valuable for membrane proteins like YfbV that often present expression challenges due to toxicity, inclusion body formation, or improper folding.

What purification strategies are most effective for isolating recombinant YfbV?

Effective purification of recombinant YfbV requires consideration of its membrane protein nature. While the search results don't provide specific purification protocols for YfbV, standard approaches for membrane proteins can be adapted:

  • Detergent-based extraction: Membrane proteins require detergents to solubilize them from the lipid bilayer. Common detergents include:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Octyl β-D-glucopyranoside (OG)

    • Digitonin

    • CHAPS

  • Affinity chromatography: If the recombinant YfbV contains an affinity tag (His-tag, GST, etc.), corresponding affinity resins can be used for initial capture. The storage buffer mentioned for commercial recombinant YfbV includes Tris-based buffer with 50% glycerol .

  • Size exclusion chromatography: As a polishing step to remove aggregates and improve homogeneity.

  • Ion exchange chromatography: Based on the protein's isoelectric point.

A typical purification workflow might include:

StepMethodPurposeConditions
1Cell lysisRelease proteinMechanical disruption or detergent lysis
2Membrane fraction isolationSeparate membrane proteinsUltracentrifugation
3Detergent solubilizationSolubilize membrane proteinsAppropriate detergent concentration
4Affinity chromatographyInitial captureBuffer optimized for tag binding
5Size exclusion chromatographyRemove aggregatesBuffer compatible with protein stability
6Quality assessmentVerify puritySDS-PAGE, Western blot, activity assay

For storing purified YfbV, a buffer similar to that used for commercial preparations (Tris-based buffer with 50% glycerol) can maintain stability. The protein should be stored at -20°C for short-term and -80°C for long-term storage, with repeated freeze-thaw cycles avoided .

How does YfbV contribute to the pathogenicity mechanisms in E. coli O6:K15:H31?

The precise contribution of YfbV to pathogenicity mechanisms in E. coli O6:K15:H31 requires further investigation, but contextual information provides valuable insights. E. coli strain 536 (O6:K15:H31) is a well-established model for studying extraintestinal pathogenic E. coli (ExPEC) . This strain contains multiple pathogenicity islands (PAIs) that harbor various virulence factors.

The K15 capsular serotype specifically has been identified in both enterotoxigenic and uropathogenic E. coli strains . The K15 capsular polysaccharide structure consists of repeating units of 4)-α-Glc pNAc-(1 → 5)-α-KDO p-(2 → partially O-acetylated at the 3-hydroxyl of GlcNAc . This capsular structure likely contributes to immune evasion and host colonization.

While YfbV's specific role is not explicitly detailed in the search results, membrane proteins in pathogenic bacteria often contribute to:

  • Adhesion to host tissues

  • Transport of nutrients or virulence factors

  • Signal transduction

  • Antimicrobial resistance

  • Biofilm formation

To elucidate YfbV's specific contribution to pathogenicity, researchers could employ:

  • Gene knockout studies to observe phenotypic changes

  • Protein-protein interaction studies to identify binding partners

  • Transcriptomic analysis under infection-relevant conditions

  • Comparative genomics across pathogenic and non-pathogenic strains

  • In vivo infection models with wild-type and yfbV mutant strains

What is the relationship between YfbV and other proteins in pathogenicity islands?

The relationship between YfbV and other proteins in pathogenicity islands (PAIs) of E. coli O6:K15:H31 represents an important area for investigation. PAIs in E. coli strain 536 range from 68 to 102 kb in size and contain numerous genes encoding virulence factors .

These PAIs exhibit several characteristic features:

  • Association with tRNA-encoding genes

  • G+C content differing from the host genome

  • Flanking repeat structures

  • Mosaic-like structure with functional and non-functional open reading frames

  • Presence of mobile genetic elements

To explore the relationship between YfbV and other PAI proteins, researchers could employ:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid assays

    • Proximity-dependent biotin identification (BioID)

  • Co-expression analysis:

    • RNA-Seq under various conditions to identify co-regulated genes

    • Quantitative PCR to verify expression patterns

  • Genomic context analysis:

    • Comparative genomics across different E. coli pathotypes

    • Identification of conserved gene neighborhoods

  • Functional studies:

    • Creation of multiple gene deletions to identify synthetic phenotypes

    • Complementation experiments to restore virulence

Understanding these relationships could provide insights into the coordinated virulence mechanisms employed by pathogenic E. coli strains and potentially identify new targets for therapeutic intervention.

How does YfbV's structure influence its function in bacterial membranes?

The structure of YfbV protein provides important clues about its potential function in bacterial membranes. According to AlphaFold computational modeling data, YfbV from E. coli ED1a has a global pLDDT confidence score of 81.8, indicating a relatively reliable structural prediction .

The protein's 151 amino acid sequence contains several hydrophobic regions consistent with its classification as a membrane protein . The computational model suggests specific structural features that may relate to its function:

  • Membrane-spanning domains: These hydrophobic regions likely anchor the protein within the bacterial membrane.

  • Confidence levels in the structural model: Different regions show varying confidence levels:

    • Very high confidence regions (pLDDT > 90)

    • Confident regions (70 < pLDDT ≤ 90)

    • Low confidence regions (50 < pLDDT ≤ 70)

    • Very low confidence regions (pLDDT ≤ 50)

These structural features may enable YfbV to:

  • Facilitate transport across the membrane

  • Participate in signal transduction

  • Contribute to membrane stability

  • Interact with host cell components during infection

To further investigate structure-function relationships, researchers could:

  • Validate the computational model using experimental structural biology techniques (X-ray crystallography, cryo-EM, NMR)

  • Perform site-directed mutagenesis of key residues identified in the structural model

  • Conduct molecular dynamics simulations to understand protein behavior in membrane environments

  • Use structure-guided approaches to identify potential binding partners or substrates

What biosafety considerations apply when working with recombinant E. coli expressing YfbV?

Working with recombinant E. coli expressing YfbV requires adherence to appropriate biosafety guidelines. Although the search results don't specify the exact biosafety level for this particular protein, general principles for working with recombinant E. coli should be followed:

  • Biosafety level assessment: Recombinant E. coli strains are typically handled at Biosafety Level 1 (BSL-1) or Biosafety Level 2 (BSL-2), depending on the strain pathogenicity and the nature of the inserted genes. Since YfbV is derived from pathogenic E. coli strains (O6:K15:H31), researchers should carefully evaluate the appropriate containment level .

  • Laboratory practices:

    • Use of personal protective equipment (lab coat, gloves, eye protection)

    • Proper hand washing before leaving the laboratory

    • No eating, drinking, or applying cosmetics in the work area

    • Proper decontamination of work surfaces

  • Waste management:

    • Chemical disinfection or autoclaving of all bacterial cultures

    • Proper disposal of solid and liquid waste according to institutional guidelines

    • Decontamination of all materials that have contacted the organisms

  • Accidental exposure protocols:

    • Development and implementation of emergency procedures

    • Reporting mechanism for spills or potential exposures

    • Appropriate medical follow-up if necessary

It's important to note that all recombinant DNA research must comply with applicable institutional and national guidelines .

What NIH guidelines should researchers follow when conducting studies with recombinant YfbV?

Researchers working with recombinant YfbV should adhere to the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. These guidelines apply to all activities involving recombinant nucleic acids, defined as "molecules that are constructed outside living cells by joining a natural or synthetic DNA segment to DNA molecules that can replicate a living cell, or molecules that result from the replication of those described above" .

Key aspects of the NIH guidelines that researchers should follow include:

  • Institutional Biosafety Committee (IBC) approval: Research involving recombinant DNA must be reviewed and approved by an IBC before initiation .

  • Risk assessment: Proper evaluation of potential hazards associated with the research, considering both the host organism (E. coli) and the inserted genetic material (yfbV gene).

  • Containment measures: Implementation of appropriate physical and biological containment measures based on the risk assessment.

  • Training requirements: Ensuring all personnel are properly trained in biosafety procedures relevant to the work.

  • Reporting requirements: Compliance with incident reporting requirements for any significant problems or violations of the guidelines.

Researchers should consult their institutional biosafety officer and review the most current version of the NIH Guidelines to ensure compliance with all applicable requirements before initiating work with recombinant YfbV .

How can recombinant YfbV be utilized in vaccine development research?

Recombinant YfbV has potential applications in vaccine development research, particularly for vaccines targeting pathogenic E. coli strains. While the search results don't specifically detail YfbV's use in vaccines, they do mention that recombinant E. coli proteins can be useful for vaccine development .

Several approaches for utilizing YfbV in vaccine research include:

  • Subunit vaccine development: Recombinant YfbV could be evaluated as a potential antigen in subunit vaccines against pathogenic E. coli strains, particularly those expressing the O6:K15:H31 serotype. If YfbV is sufficiently conserved across pathogenic strains, it might provide cross-protection against multiple serotypes.

  • Immunogenicity studies: Research could assess the ability of YfbV to elicit protective immune responses, including:

    • Antibody production (humoral immunity)

    • T-cell responses (cellular immunity)

    • Mucosal immunity (relevant for intestinal pathogens)

  • Adjuvant research: YfbV could be studied in combination with various adjuvants to enhance immune responses in preclinical models.

  • Antigen delivery systems: Incorporation of YfbV into different delivery platforms (liposomes, virus-like particles, nanoparticles) could be evaluated for improved immunogenicity.

  • Reverse vaccinology approaches: Computational analysis of YfbV structure could identify potential epitopes for targeted vaccine design.

It's important to note that all recombinant products, including YfbV, used in research can only be utilized for research purposes and cannot be used directly on humans or animals without appropriate regulatory approvals .

What techniques are available for studying YfbV interactions with host cells?

Investigating YfbV interactions with host cells requires specialized techniques that can detect and characterize protein-protein or protein-cell interactions. Several methodologies are available:

  • In vitro binding assays:

    • ELISA-based binding assays using purified recombinant YfbV

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Cell-based assays:

    • Flow cytometry to detect YfbV binding to host cells

    • Immunofluorescence microscopy to visualize localization

    • Cell adhesion/invasion assays to determine functional effects

  • Proteomics approaches:

    • Pull-down assays coupled with mass spectrometry

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Proximity labeling methods (BioID, APEX) to identify proteins in close proximity

  • Structural biology:

    • X-ray crystallography or cryo-EM of YfbV-host protein complexes

    • NMR spectroscopy for studying interaction dynamics

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

  • Functional assays:

    • Host cell signaling pathway activation studies

    • Cytokine production measurements

    • Cell viability and cytotoxicity assays

These techniques can be complementary, and combining multiple approaches provides more comprehensive insights into YfbV-host interactions. Understanding these interactions could reveal mechanisms of pathogenesis and potential targets for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.