Recombinant Escherichia coli O6:K15:H31 UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Overview of UPF0259 Membrane Protein yciC

The UPF0259 membrane protein yciC is a protein of unknown function, classified under the UPF0259 family. It is often expressed in Escherichia coli for structural and functional studies. The protein is typically fused with a His-tag for easy purification and identification.

Characteristics of Recombinant UPF0259 Membrane Protein yciC

  • Species: Originally from Salmonella species, such as Salmonella Newport or Salmonella Schwarzengrund.

  • Source: Expressed in Escherichia coli.

  • Tag: N-terminal His-tag.

  • Protein Length: Full-length, typically 247 amino acids.

  • Form: Lyophilized powder.

  • Purity: Greater than 90% as determined by SDS-PAGE.

Expression and Purification

The UPF0259 membrane protein yciC is expressed in Escherichia coli using standard recombinant DNA technology. The protein is purified using affinity chromatography due to its His-tag.

Research Findings

While specific research findings on the Recombinant Escherichia coli O6:K15:H31 UPF0259 membrane protein yciC (yciC) are not available, studies on similar proteins in Escherichia coli and other bacteria provide insights into membrane protein functions and interactions.

Membrane Proteins in Bacteria

Membrane proteins like YidC in Escherichia coli play crucial roles in membrane integration and protein synthesis. They can function independently of the Sec translocase to insert proteins into the membrane bilayer .

Comparative Genomics

Comparative genomic analyses of Escherichia coli strains reveal significant diversity in gene content, which influences pathogenicity and virulence. For example, uropathogenic Escherichia coli (UPEC) strains have specific genes that contribute to their pathogenic potential .

Data Table: Characteristics of Recombinant UPF0259 Membrane Protein yciC

CharacteristicDescription
SpeciesOriginally from Salmonella species
SourceExpressed in Escherichia coli
TagN-terminal His-tag
Protein LengthFull-length, typically 247 amino acids
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C or -80°C
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
yciC; ECP_1303; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGVFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links

KEGG: ecp:ECP_1303

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yciC protein and what is its confirmed function in E. coli?

yciC is a UPF0259 family inner membrane protein in E. coli with 247 amino acids. While its precise function remains under investigation, experimental evidence indicates it likely functions as a metallochaperone involved in zinc homeostasis. The protein was originally identified as an abundant, membrane-associated protein in extracts of zur mutant cells, suggesting a role in metal ion trafficking . Sequence comparisons indicate similarities with factors implicated in protein metallation reactions, providing further evidence for its potential role as a metallochaperone .

How is the yciC gene regulated in bacteria?

In Bacillus subtilis, the yciC gene is regulated by the Zur protein, which controls zinc homeostasis by repressing at least 10 genes in response to zinc sufficiency. The regulation occurs through two functional Zur boxes: a primary site (C2) overlapping a σA promoter approximately 200 bp upstream of yciC and a second site near the translational start point (C1). Zur binds to both sites to mediate strong, zinc-dependent repression of yciC . While the regulation may differ in E. coli, this provides insight into how yciC expression is controlled in response to zinc availability in bacterial systems.

What protein interactions has yciC been shown to participate in?

Based on STRING database analysis, yciC has predicted functional partnerships with several proteins, most notably :

ProteinFunctionInteraction Score
yciBIspA family inner membrane protein involved in cell division0.973
yciAAcyl-CoA esterase that catalyzes hydrolysis of thioester bonds0.955
yjiAMetal-binding GTPase with low GTPase activity0.789
yeiRZn-stimulated GTPase involved in zinc homeostasis0.739
hypBGTP hydrolase involved in nickel liganding into hydrogenases0.527
znuAZinc ABC transporter periplasmic binding protein0.513

These interactions, particularly with other proteins involved in metal homeostasis, support the hypothesis that yciC plays a role in zinc trafficking or metallation processes in E. coli.

What expression systems are recommended for recombinant yciC production?

Expression methodology:

  • Clone the yciC gene into a pET vector (medium copy number, pMB1 origin)

  • Transform into BL21(DE3) or C41(DE3) for initial screening

  • Consider using pLysS or pLysE plasmids to tightly control expression

  • For difficult expression, test cold-inducible systems (cspA promoter, 15°C induction)

How can I optimize soluble expression of yciC membrane protein?

Optimizing soluble expression of membrane proteins like yciC requires special consideration:

  • Temperature modulation: Lower induction temperature (15-25°C) often increases solubility by slowing protein synthesis and folding rates.

  • Inducer concentration: Use lower IPTG concentrations (0.1 mM or less) to reduce toxicity effects . Recent studies suggest that excessive amounts of exogenous mRNA may outcompete endogenous mRNA, impairing host viability.

  • Growth phase at induction: Induce at higher cell densities (OD600 of 0.8 rather than 0.5) to increase cell tolerance to membrane protein expression .

  • Media composition: Consider supplementing with glucose (1 g/L) and using richer media formulations to provide building blocks for membrane synthesis .

  • Fusion partners: Express yciC as a fusion with solubility enhancers or tags that aid in membrane protein folding.

A factorial design approach is recommended for systematic optimization. In one study with recombinant protein expression, researchers developed optimized conditions including growth until OD600 of 0.8, induction with 0.1 mM IPTG for 4 hours at 25°C in a medium containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose .

What purification strategies are most effective for recombinant yciC?

For membrane proteins like yciC, purification typically involves:

  • Membrane fractionation: Separate membrane fractions through differential centrifugation following cell lysis.

  • Detergent solubilization: Carefully select detergents for solubilization; start screening with mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG).

  • Affinity chromatography: Employ histidine tags for immobilized metal affinity chromatography (IMAC). Position the tag at the end that is predicted to be solvent-accessible based on structural models .

  • Size exclusion chromatography: As a polishing step to achieve high purity and to confirm proper oligomeric state.

Monitor protein quality through SDS-PAGE, Western blotting, and if possible, functional assays to ensure the purified protein maintains its native conformation.

How can recombinant yciC be utilized to study bacterial zinc homeostasis?

To use recombinant yciC for zinc homeostasis studies:

  • Metal binding assays: Employ isothermal titration calorimetry (ITC) or fluorescence spectroscopy to characterize zinc binding properties of purified yciC.

  • Protein-protein interaction studies: Investigate interactions between yciC and other zinc homeostasis proteins (znuA, yeiR, Zur) using pull-down assays, cross-linking, or surface plasmon resonance.

  • Expression profiling: Monitor yciC expression under varying zinc concentrations using qPCR or reporter fusion constructs. Compare with expression of known zinc-regulated genes.

  • Cellular localization: Use fluorescent protein fusions to track subcellular localization of yciC under different zinc concentrations to gain insights into its trafficking function.

  • Mutation analysis: Create point mutations in predicted metal-binding residues to assess changes in zinc binding affinity and cellular phenotypes.

The regulatory relationship between yciC and zinc homeostasis makes it a valuable tool for understanding how bacteria maintain appropriate zinc levels, which is critical for survival and virulence.

What is the relationship between yciC expression and endotoxin levels in E. coli?

Recent research shows that upregulation of YciM expression reduces endotoxin contamination in recombinant protein production in E. coli . While yciM and yciC are different proteins, this finding suggests potential interactions between membrane proteins in the yci family and lipopolysaccharide (LPS) biosynthesis pathways.

Two approaches for engineering strains with reduced LPS levels were compared:

  • Modification of LPS biosynthesis by knocking out seven genes in the E. coli genome

  • Increasing expression of E. coli protein YciM, which reduces the amount of LpxC enzyme involved in LPS biosynthesis

Both approaches provided similar outcomes in decreasing endotoxin levels in purified protein samples . This research opens possibilities for investigating whether yciC might also play a role in membrane composition or endotoxin regulation.

How does yciC contribute to bacterial stress responses?

While specific data on yciC's role in stress response is limited, research on related proteins in the yci operon provides insights. For example, YciG has been shown to be important for stationary-phase resistance to thermal stress, oxidative stress, and particularly acid stress in E. coli .

YciG was demonstrated to be required for RpoS-independent acid resistance, suggesting a potential connection between the yci gene family and stress adaptation mechanisms . Given that yciC is predicted to be in an operon with yciF and yciE genes, it may have related functions in stress response pathways.

To investigate yciC's role in stress responses:

  • Generate clean deletion mutants lacking yciC

  • Test mutant strains against various environmental stresses (acid, oxidative, thermal)

  • Perform complementation studies to confirm phenotypes

  • Monitor expression of yciC under different stress conditions

  • Explore potential interactions with stress response regulators

How can I address the challenge of metabolic burden during recombinant yciC expression?

Metabolic burden is a significant challenge when expressing recombinant proteins in E. coli. Recent proteomics studies reveal that recombinant protein production causes significant changes in both transcriptional and translational machinery that impact growth rate and protein yield .

To minimize metabolic burden during yciC expression:

  • Optimize induction timing: The timing of protein synthesis induction plays a critical role in the fate of the recombinant protein. Recent proteomics studies show that inducing at different growth phases significantly affects host cell response .

  • Strain selection: Different E. coli strains show significant differences in expression characteristics. For example, E. coli M15 strain demonstrated superior expression characteristics compared to DH5α due to differences in fatty acid and lipid biosynthesis pathways .

  • Decoupling strategies: Consider systems like BL21-AI<gp2> where cell growth is decoupled from recombinant protein production. This approach uses a phage-derived inhibitor peptide that blocks E. coli RNA polymerase but not T7 RNA polymerase .

  • Vector design: Choose appropriate plasmid copy number. High plasmid dosage doesn't necessarily mean more recombinant protein yield, as it may impose metabolic burden and decrease bacterial growth rate .

  • Antibiotic selection: For maintaining plasmid stability, consider alternatives to ampicillin. Since β-lactamase is continuously secreted, ampicillin is depleted after a couple of hours. Tetracycline has been shown to be more stable during cultivation .

What approaches can resolve inclusion body formation with yciC expression?

As a membrane protein, yciC is prone to form inclusion bodies when overexpressed. Several strategies can help improve solubility:

  • Chaperone co-expression: Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist in proper protein folding.

  • Fusion partners: Test solubility-enhancing fusion partners like MBP (maltose-binding protein), SUMO, or TrxA (thioredoxin).

  • Signal sequences: Direct the protein to the periplasm using signal peptides like PelB, DsbA, or OmpA to take advantage of the oxidizing environment and specialized folding machinery .

  • Inclusion body refolding: If inclusion bodies persist, develop a refolding protocol using mild detergents and a controlled redox environment.

  • Strain engineering: Use specialized strains with oxidizing cytoplasm (like Origami) if disulfide bonds are critical for yciC folding and function .

For membrane proteins like yciC, inclusion bodies sometimes provide a simple method for achieving significant one-step purification, provided the protein can be refolded efficiently in vitro with appropriate detergents .

How can I verify the proper folding and function of recombinant yciC?

Verifying proper folding of membrane proteins like yciC presents unique challenges:

  • Circular Dichroism (CD) Spectroscopy: Assess secondary structure content in detergent solutions.

  • Metal-binding assays: If yciC functions as a metallochaperone as suggested, zinc-binding assays using isothermal titration calorimetry or zinc-sensitive fluorescent probes can confirm functionality.

  • Protein-protein interaction tests: Verify interactions with known partners (yciA, yciB) using pull-down assays or surface plasmon resonance.

  • Complementation studies: Test if the recombinant protein can restore function in yciC knockout strains under zinc-limited conditions.

  • Thermal stability assays: Monitor thermal denaturation profiles in the presence and absence of zinc to confirm metal-dependent stabilization.

  • Size-exclusion chromatography: Ensure the protein elutes at the expected molecular weight and doesn't form non-specific aggregates.

What are promising areas for future yciC research based on current findings?

Several promising research directions emerge from current literature:

  • Detailed structural characterization: Determine the three-dimensional structure of yciC through X-ray crystallography or cryo-EM to identify potential metal-binding sites and functional domains.

  • Metal specificity profiling: While evidence suggests involvement in zinc homeostasis, comprehensively test binding to other biologically relevant metals to determine specificity.

  • Systems biology approach: Integrate transcriptomics, proteomics, and metabolomics data to understand how yciC fits into broader cellular networks, particularly under stress conditions and varying metal concentrations.

  • Investigation of yciABC operon coordination: Explore how yciC functions in concert with yciA and yciB, possibly forming a functional complex that contributes to membrane integrity or metal trafficking.

  • Pathogen-host interactions: Examine potential roles of yciC in bacterial virulence or survival within host environments where metal availability is limited through nutritional immunity.

  • Application in biotechnology: Explore whether manipulation of yciC expression could improve recombinant protein production in E. coli by optimizing metal availability for metalloproteins or reducing endotoxin levels.

How might advances in protein expression systems impact future yciC research?

Recent innovations in expression technologies will likely impact yciC research:

  • Cell-free protein synthesis systems: May allow expression of toxic membrane proteins like yciC without cellular viability constraints.

  • Glycosylation engineering in E. coli: New capacities for humanized N-glycosylation in E. coli could enable studies of how post-translational modifications affect yciC function.

  • Advanced induction systems: Temperature-sensitive, cold-inducible, or switchable systems that decouple cell growth from recombinant protein production could improve yciC yields .

  • AI-assisted protein expression optimization: Artificial intelligence tools are beginning to clarify issues related to metabolic burden and may help predict optimal conditions for yciC expression .

  • Improved membrane protein solubilization techniques: New detergents, nanodiscs, and amphipols offer better platforms for functional studies of membrane proteins like yciC.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.