Recombinant Escherichia coli O6:K15:H31 UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O6:K15:H31 UPF0442 Protein YjjB (yjjB)

Recombinant Escherichia coli O6:K15:H31 UPF0442 protein YjjB (yjjB) is a 157-amino-acid protein encoded by the yjjB gene (UniProt ID: Q0T8U9). This protein is expressed in E. coli strain 536 (O6:K15:H31), a uropathogenic E. coli (UPEC) isolate associated with acute pyelonephritis . The recombinant form is fused to an N-terminal polyhistidine (His) tag for affinity purification and research applications, such as structural studies and immunoassays .

Key Properties

PropertyDescription
Gene NameyjjB (ECP_4694)
Protein LengthFull-length (1-157 amino acids)
Molecular Weight~18 kDa (calculated)
Expression SystemE. coli (e.g., LOBSTR strain optimized for His-tag purification)
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
SequenceMGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIEWSTFMASMLVGTIGIQWSRWYLAHPKV...

The protein is classified as a UPF0442 family member, though its exact biochemical function remains uncharacterized .

Production and Purification Methods

Recombinant YjjB is produced using the LOBSTR (Low Background Strain) E. coli expression system, which minimizes contamination from native histidine-rich proteins like ArnA and SlyD during affinity purification . Key steps include:

  • Induction: IPTG (up to 1 mM) at 18–37°C.

  • Purification: Ni-NTA, Talon, or Ni Sepharose resins for His-tag affinity chromatography .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C .

Comparative Purification Performance

StrainContaminants RemovedTarget Protein Purity
BL21(DE3)ArnA, SlyD presentModerate
LOBSTRArnA, SlyD eliminatedHigh (>90%)
Data adapted from Andersen et al. (2013) .

Role in E. coli Strain 536 Virulence

YjjB is located within Pathogenicity Island II (PAI II<sub>536</sub>), a 102-kb genomic region flanked by 18-bp direct repeats and associated with tRNA gene leuX . Key features:

  • Virulence-Linked ORFs: Co-located with genes encoding hemolysins, adhesins (e.g., P-fimbriae), and a filamentous hemagglutinin-like protein homologous to Bordetella pertussis and Yersinia pestis virulence factors .

  • Horizontal Gene Transfer: PAI II<sub>536</sub> shares homology with virulence plasmids of Shigella flexneri and E. coli O157:H7, suggesting evolutionary acquisition via mobile genetic elements .

Applications in Research

  1. Immunoassays: Used as an antigen in ELISA kits for antibody production and diagnostic studies .

  2. Protein Interaction Studies: Identified as part of metabolic pathways involving nucleotide synthesis and stress response in proteomic analyses .

  3. Recombinant Protein Standards: High purity enables use in quantitative mass spectrometry and structural biology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. Please indicate any format requirements in your order notes, and we will strive to accommodate your request.
Lead Time
Delivery timelines can vary based on purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended for long-term preservation. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yjjB; ECP_4694; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
yjjB
Target Protein Sequence
MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIE WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: ecp:ECP_4694

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0442 protein yjjB and why is it significant for research?

UPF0442 protein yjjB is a membrane protein encoded by the yjjB gene in Escherichia coli O6:K15:H31, particularly in uropathogenic strain 536. The protein's significance stems from its location in the cell membrane as a multi-pass membrane protein that belongs to the UPF0442 family . Its precise function remains largely uncharacterized, making it a valuable research target for understanding bacterial membrane biology and potential roles in pathogenicity. The protein is notable for researchers because it represents one of many proteins in E. coli with unknown functions that may contribute to bacterial adaptation, survival mechanisms, or virulence.

What are the structural characteristics of recombinant yjjB protein?

The recombinant UPF0442 protein yjjB spans positions 1-157 of the amino acid sequence with a molecular weight of approximately 17,047 Da . Its complete amino acid sequence is: MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIEWSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEPLMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV . Structurally, it features multiple transmembrane domains consistent with its classification as a multi-pass membrane protein. Topological analysis suggests it contains multiple hydrophobic regions that anchor the protein within the bacterial cell membrane, with both cytoplasmic and periplasmic domains likely contributing to its functional capabilities.

What are the recommended protocols for expression and purification of recombinant yjjB protein?

When expressing and purifying recombinant yjjB protein, researchers should implement a systematic approach optimized for membrane proteins. The expression system typically employs E. coli, yeast, baculovirus, or mammalian cell hosts depending on research requirements . For bacterial expression, BL21(DE3) or similar strains are recommended with IPTG induction under controlled temperature conditions (often 18-25°C) to prevent inclusion body formation and promote proper membrane insertion.

Purification requires specialized protocols for membrane proteins, beginning with cellular disruption via sonication or French press, followed by membrane fraction isolation through differential centrifugation. The protein can be solubilized using detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS, with concentrations optimized to maintain protein stability. Affinity chromatography leveraging the recombinant tag (typically His-tag, though tag types may vary depending on the specific product preparation) followed by size exclusion chromatography typically yields protein with ≥85% purity as assessed by SDS-PAGE. Storage in a Tris-based buffer with 50% glycerol at -20°C or -80°C maintains stability, with repeated freeze-thaw cycles strongly discouraged .

How can researchers verify the structural integrity and functionality of purified yjjB protein?

Verification of structural integrity and functionality requires a multi-faceted analytical approach. Begin with basic SDS-PAGE analysis to confirm molecular weight (approximately 17,047 Da) and Western blotting for immunological detection . For structural assessment, circular dichroism spectroscopy provides information about secondary structure elements, while dynamic light scattering evaluates homogeneity and aggregation state.

For membrane proteins like yjjB, additional techniques include proteoliposome reconstitution to assess membrane insertion capability. Tryptophan fluorescence spectroscopy can monitor conformational changes, particularly given the protein's tryptophan residues evident in its sequence (specifically WSRWYLAH section) . While specific assays for yjjB's uncharacterized function present challenges, researchers can employ surrogate measurements such as binding assays with potential substrates, membrane potential assessments, or growth complementation studies in knockout strains. Native mass spectrometry or hydrogen-deuterium exchange mass spectrometry provides insights into structural dynamics and potential interaction partners that might illuminate function.

What techniques are recommended for studying yjjB's membrane topology?

Understanding the membrane topology of yjjB requires specialized techniques tailored for integral membrane proteins. Computational prediction using algorithms like TMHMM or Phobius provides initial topology models, but experimental validation is essential. Cysteine scanning mutagenesis combined with accessibility studies using membrane-permeable and impermeable sulfhydryl reagents can experimentally map transmembrane regions.

Protease protection assays using proteases like trypsin or chymotrypsin on intact membrane vesicles versus detergent-solubilized samples help determine cytoplasmic versus periplasmic domain orientation. For higher precision, researchers should consider site-directed fluorescence labeling at predicted loop regions, with subsequent quenching assays to confirm exposure. Alternatively, epitope insertion followed by immunofluorescence microscopy in selectively permeabilized cells provides visual confirmation of domain localization. For detailed structural analysis, electron crystallography or cryo-electron microscopy of 2D crystals may be attempted, though these techniques require significant optimization for membrane proteins like yjjB.

How might yjjB contribute to pathogenicity in uropathogenic E. coli strains?

While yjjB is not directly located within the characterized pathogenicity islands (PAIs) of uropathogenic E. coli 536, its role as a membrane protein suggests potential contributions to bacterial adaptation during infection . As a multi-pass membrane protein, yjjB could participate in pathogenicity through several hypothesized mechanisms: regulation of membrane permeability, facilitation of nutrient acquisition in the urinary tract environment, modulation of cellular responses to antimicrobial compounds, or participation in stress response pathways activated during host-pathogen interactions.

The pathogenicity of E. coli 536 depends on virulence factors encoded within its five PAIs, including α-hemolysin clusters, P-related fimbriae, S-fimbriae, and siderophore systems . While yjjB is not among these characterized virulence factors, membrane proteins often function in concert with virulence systems by maintaining membrane integrity during environmental stresses or facilitating the export of virulence factors. Research approaches to investigate these potential roles include creating yjjB knockout strains and evaluating changes in virulence in infection models, performing transcriptomic analysis to identify co-regulation with known virulence factors, or utilizing bacterial two-hybrid systems to identify protein-protein interactions with components of virulence pathways.

What approaches can be used to identify potential interaction partners of yjjB protein?

Identifying interaction partners requires comprehensive protein-protein interaction mapping strategies adapted for membrane proteins. Pull-down assays represent an effective starting point, utilizing the recombinant yjjB with affinity tags for bait in E. coli lysates, followed by mass spectrometry to identify captured proteins. For membrane-specific interactions, cross-linking experiments using membrane-permeable cross-linkers like DSP (dithiobis(succinimidyl propionate)) can stabilize transient interactions prior to isolation.

Bacterial two-hybrid or split-ubiquitin membrane yeast two-hybrid systems provide in vivo validation of interactions, though optimization for membrane proteins is essential. For higher-throughput analysis, protein microarrays containing E. coli proteins can be probed with labeled yjjB. Proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling, when adapted for bacterial systems, enables identification of the proximal protein neighborhood within the membrane environment. Computational approaches using co-expression analysis of transcriptomic datasets from various growth conditions can predict functional associations. Integration of these multiple approaches provides a confidence-ranked network of potential interaction partners that informs functional hypotheses.

How can researchers study the expression regulation of yjjB under different environmental conditions?

Understanding yjjB expression regulation requires a systematic examination across relevant environmental conditions that mimic bacterial lifecycle phases and host environments. Quantitative RT-PCR represents a primary approach for measuring transcriptional changes in yjjB expression across conditions such as pH shifts, osmotic stress, nutrient limitation, and growth phases.

For more comprehensive analysis, researchers should construct transcriptional fusions using the yjjB promoter region with reporter genes like lacZ or GFP to visualize expression patterns in real-time. RNA-seq provides genome-wide context for yjjB regulation within global transcriptional networks. For protein-level regulation, Western blotting with anti-yjjB antibodies or quantitative proteomics can track changes in protein abundance. To identify regulatory elements, chromatin immunoprecipitation sequencing (ChIP-seq) with antibodies against RNA polymerase or known transcription factors can map protein-DNA interactions at the yjjB locus. Mutational analysis of predicted binding sites in the promoter region followed by expression analysis confirms the functionality of these regulatory elements. This multi-level approach provides a comprehensive understanding of how yjjB expression responds to environmental cues.

How conserved is yjjB across different E. coli strains and related bacteria?

The UPF0442 protein yjjB shows interesting patterns of conservation across bacterial species that provide insights into its evolutionary significance. Comparative genomic analysis reveals that yjjB belongs to the UPF0442 family, with homologs present across multiple E. coli strains including pathogenic variants like O157:H7 and uropathogenic strain 536 (O6:K15:H31) . Sequence similarity searches using BLAST against bacterial genome databases indicate conservation across the Enterobacteriaceae family, suggesting an ancient origin predating the diversification of this bacterial family.

When examining conservation at the amino acid level, transmembrane domains typically show higher conservation than loop regions, reflecting functional constraints on membrane-spanning segments. Researchers investigating evolutionary patterns should employ multiple sequence alignment tools like MUSCLE or CLUSTALΩ, followed by phylogenetic tree construction using maximum likelihood methods. Conservation analysis should include examination of selection pressure using dN/dS ratios to identify regions under purifying or positive selection. These analyses help contextualize the protein's importance in bacterial physiology and potentially identify functionally critical residues that remain invariant across diverse species.

What structural and functional predictions can be made about yjjB based on bioinformatic analysis?

Bioinformatic analysis provides valuable insights into potential structural features and functions of yjjB despite limited experimental characterization. Transmembrane topology prediction algorithms consistently identify 4-6 transmembrane helices, positioning yjjB as a multi-pass membrane protein . Secondary structure predictions suggest alpha-helical content within the transmembrane regions with potential beta-strand elements in loop regions.

Structural homology modeling using algorithms like I-TASSER or AlphaFold can generate tertiary structure predictions that, while speculative without experimental validation, provide testable hypotheses about protein folding and potential binding pockets. Researchers should validate these predictions through targeted mutagenesis of predicted functional residues followed by phenotypic or biochemical analysis.

What are common challenges in working with recombinant yjjB protein and how can they be addressed?

Working with recombinant membrane proteins like yjjB presents several technical challenges that require specialized approaches. Expression difficulties commonly arise from protein toxicity, inclusion body formation, or inefficient membrane insertion. To address these issues, researchers should optimize expression conditions by testing multiple expression systems (bacterial, yeast, baculovirus, mammalian) , varying induction parameters (temperature, inducer concentration, duration), and incorporating fusion partners that enhance membrane targeting or solubility.

Purification challenges include low yield and protein instability during extraction from membranes. Screening multiple detergents (DDM, CHAPS, digitonin) at various concentrations helps identify optimal solubilization conditions. Adding stabilizers like glycerol (50%), specific lipids, or cholesterol to purification buffers can maintain native conformation . For protein that forms inclusion bodies despite optimization, researchers can attempt refolding protocols specifically developed for membrane proteins, using controlled reconstitution into lipid bilayers or nanodiscs.

Aggregation during storage represents another common issue. Researchers should examine buffer conditions (pH, ionic strength), storage temperature (-20°C to -80°C), and additives (glycerol, reducing agents) to identify optimal stability conditions . Analytical techniques like dynamic light scattering or size exclusion chromatography help monitor aggregation state. When designing experiments, allocating protein into single-use aliquots prevents degradation from repeated freeze-thaw cycles.

How can researchers design experiments to elucidate the function of yjjB?

Elucidating the function of poorly characterized proteins like yjjB requires a multi-faceted experimental strategy combining genetic, biochemical, and physiological approaches. Gene deletion studies serve as a foundational approach, with phenotypic characterization of ΔyjjB mutants under various conditions (different carbon sources, pH levels, osmotic stresses, or antimicrobial compounds) to identify conditions where the protein becomes essential or contributes to fitness.

Complementary to genetic approaches, localization studies using fluorescent protein fusions or immunolocalization help confirm membrane topology and potentially identify subcellular regions of enrichment that suggest functional roles. Metabolomic analysis comparing wild-type and ΔyjjB strains may reveal altered metabolite profiles that indicate involvement in specific biochemical pathways.

For biochemical characterization, reconstitution of purified protein into proteoliposomes allows testing of potential transport activities using radioisotope-labeled substrates or fluorescent probes sensitive to electrochemical gradients. Thermal shift assays or microscale thermophoresis in the presence of potential ligands can identify binding partners that hint at function. Integration of data from these complementary approaches, combined with insights from co-expression analysis and structural predictions, maximizes the probability of accurately assigning function to this uncharacterized protein.

What statistical approaches are recommended for analyzing protein-protein interaction data involving yjjB?

Protein-protein interaction studies with yjjB require robust statistical analyses to distinguish genuine interactions from background noise, particularly given the challenges of membrane protein interactions. For affinity purification-mass spectrometry (AP-MS) data, significance analysis of interactome (SAINT) algorithm provides statistical modeling specifically designed for interaction proteomics, calculating probability scores for each potential interaction.

Implementation of appropriate controls is essential, including non-specific binding controls (e.g., using unrelated membrane proteins or empty vectors) and technical replicates (minimum of three) to enable statistical validation. Researchers should apply false discovery rate (FDR) control methods like Benjamini-Hochberg procedure with thresholds typically set at 1% or 5% depending on stringency requirements. Volcano plots presenting fold enrichment versus statistical significance provide visual representation of interaction data, with genuine interactors appearing in the upper-right quadrant.

Network analysis tools like Cytoscape with plugins such as BiNGO help contextualize interactions within functional pathways through Gene Ontology enrichment analysis. For validating high-confidence interactions, orthogonal methods (bacterial two-hybrid, co-immunoprecipitation, FRET) should confirm key findings. When integrating data from multiple experimental approaches, researchers can apply Bayesian integration frameworks that weight evidence based on the reliability of each method, producing confidence-ranked interaction networks that prioritize candidates for functional validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.