Recombinant Escherichia coli O6:K15:H31 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include them in your order notes and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yihY; ECP_4095; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links

KEGG: ecp:ECP_4095

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0761 membrane protein YihY in Escherichia coli O6:K15:H31?

YihY is a membrane protein belonging to the UPF0761 (Uncharacterized Protein Family 0761) classification in Escherichia coli O6:K15:H31 (strain 536 / UPEC). This protein is part of the BrkB/YihY/UPF0761 family and is specifically noted not to function as an RNase . The protein is encoded by the yihY gene (locus name ECP_4095) and represents a full-length protein with 290 amino acids . As a membrane protein, YihY is integrated into the bacterial cell membrane, though its precise functional role remains under investigation.

How should recombinant YihY protein be stored for optimal stability in laboratory settings?

For routine laboratory use, the recombinant YihY protein should be stored according to these guidelines:

  • Store at -20°C for standard storage

  • For extended storage, maintain at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as they can degrade protein integrity

  • Working aliquots can be maintained at 4°C for up to one week

These storage conditions are optimized to preserve protein structure and function. When working with this protein, it's recommended to prepare small working aliquots to minimize freeze-thaw cycles. The protein is typically provided in a Tris-based buffer with 50% glycerol that has been optimized for this specific protein .

What methodological approaches are recommended for studying membrane localization of YihY?

For investigating the membrane localization of YihY, researchers should consider a multi-faceted approach:

  • Subcellular Fractionation Techniques:

    • Differential centrifugation to separate membrane fractions

    • Sucrose gradient ultracentrifugation for refined membrane separation

    • Western blot analysis of fractions using anti-YihY antibodies

  • Fluorescence Microscopy:

    • Construction of YihY-GFP (or other fluorescent tag) fusion proteins

    • Live-cell imaging to visualize membrane localization

    • Co-localization studies with known membrane markers

  • Membrane Protein Extraction Methods:

    • Detergent-based extraction (similar to the DDM method used for YidC and YibN )

    • Optimization of detergent concentrations for YihY solubilization

    • Analysis of extracted protein by Blue Native-PAGE or SDS-PAGE

  • Protease Accessibility Assays:

    • Inverted membrane vesicle (INV) preparation

    • Proteinase K digestion to determine topology

    • Analysis of membrane-protected fragments by SDS-PAGE

These approaches can be adapted from protocols used for similar membrane proteins like YibN, which has been successfully studied using detergent extraction with 1% DDM and purification via Ni-NTA chromatography .

How does YihY potentially interact with other membrane proteins in E. coli?

While direct evidence of YihY interactions is limited in the provided research, we can draw methodological parallels from studies of other membrane protein interactions:

  • Proximity-dependent Biotin Labeling (BioID):

    • This approach was successfully used to identify YibN as an interactor of YidC

    • The method could be applied to YihY by creating a YihY-BioID fusion protein

    • After expression, biotinylated proteins can be purified and identified by mass spectrometry

  • Affinity Purification-Mass Spectrometry:

    • His-tagged YihY could be purified from native membranes

    • Interacting proteins would co-purify and could be identified by mass spectrometry

    • This method confirmed YidC-YibN interaction in native membranes

  • Blue Native-PAGE Analysis:

    • Purified YihY can be incubated with potential interacting partners

    • Complex formation can be visualized on blue-native gels

    • This technique successfully detected YidC-YibN complexes

  • On-gel Binding Assays:

    • Purified proteins can be analyzed for direct interactions

    • Domain mapping can identify crucial interaction regions

    • The importance of transmembrane segments in interactions can be evaluated, as demonstrated with YibN's TMS being essential for YidC interaction

These methodologies provide a framework for investigating potential YihY interactions with other membrane proteins in a manner similar to established protocols for other bacterial membrane protein studies.

What techniques are recommended for optimizing expression and purification of recombinant YihY?

Based on successful approaches with similar membrane proteins, researchers should consider the following protocols for YihY expression and purification:

Expression Optimization:

  • Vector Selection and Design:

    • Use of pBAD expression vectors with arabinose-inducible promoters (similar to successful YidC and YibN expression)

    • Inclusion of appropriate His-tag (N or C-terminal) for purification

    • Codon optimization for E. coli expression systems

  • Expression Conditions:

    • Test multiple E. coli strains (BL21(DE3) has been successful for other membrane proteins)

    • Optimize induction parameters:

      • Temperature (room temperature to 37°C)

      • Inducer concentration (e.g., 0.1-0.2% arabinose)

      • Duration (15 minutes to overnight)

Purification Protocol:

  • Membrane Isolation:

    • Cell lysis by French press or sonication

    • Differential centrifugation to isolate membrane fraction

    • Sucrose gradient purification if needed

  • Detergent Solubilization:

    • Test multiple detergents (DDM at 1% has been effective for similar proteins)

    • Solubilize membranes for 1 hour at 4°C with gentle shaking

    • Remove insoluble material by ultracentrifugation (100,000 x g, 15 minutes)

  • Affinity Chromatography:

    • Pass detergent extract through Ni-NTA column

    • Wash with buffer containing low imidazole (20 mM)

    • Elute with buffer containing high imidazole (600 mM)

  • Quality Control:

    • Analyze purity by SDS-PAGE

    • Verify native state by Blue Native-PAGE

    • Assess functionality through appropriate assays

This systematic approach, adapted from successful purification of other bacterial membrane proteins, provides a framework for obtaining pure, functional YihY protein for further studies.

What are the predicted functional domains and motifs in YihY?

Analysis of the YihY amino acid sequence reveals several structural and functional features that provide insights into its potential role:

Domain/MotifPositionPredicted Function
Transmembrane segmentsMultiple regionsMembrane anchoring and integration
BrkB/YihY/UPF0761 family domainThroughout proteinUnknown function, not an RNase
Hydrophobic core regionsVarious segmentsMembrane interaction and stability
N-terminal region1-29Potentially important for protein-protein interactions (by analogy with YibN)

The protein appears to have multiple transmembrane segments consistent with its classification as a membrane protein. While specific enzymatic domains haven't been definitively identified, the protein's classification in the BrkB/YihY/UPF0761 family suggests potential roles in membrane organization or protein-protein interactions at the membrane interface.

How can researchers assess the impact of YihY on membrane organization and integrity?

To evaluate YihY's potential role in membrane organization, researchers should consider these experimental approaches:

  • Membrane Lipid Analysis:

    • Extract and quantify membrane lipids from YihY-overexpressing strains

    • Analyze lipid composition by thin-layer chromatography (TLC)

    • Compare with control strains to identify changes in phospholipid profiles

  • Electron Microscopy Studies:

    • Prepare YihY-overexpressing cells for transmission electron microscopy

    • Analyze membrane morphology and organization

    • Look for membrane proliferation or structural changes similar to those observed with YibN overexpression

  • Membrane Fluidity Assays:

    • Use fluorescent membrane probes to assess membrane fluidity

    • Compare fluidity in YihY-overexpressing and control cells

    • Measure fluorescence anisotropy to quantify changes

  • Protein Insertion Assays:

    • Prepare inverted membrane vesicles (INVs) from YihY-enriched membranes

    • Test capacity for insertion of model membrane proteins

    • Compare with control INVs to assess YihY's impact on membrane protein biogenesis

These methodologies can reveal whether YihY, like YibN, affects membrane proliferation, lipid composition, or the insertion of other membrane proteins, providing insights into its functional role in bacterial membrane biology.

What bioinformatic approaches can help predict the function of uncharacterized proteins like YihY?

For predicting functions of uncharacterized proteins such as YihY, researchers should implement a comprehensive bioinformatic workflow:

  • Sequence-Based Analysis:

    • Multiple sequence alignment with homologs

    • Identification of conserved residues across species

    • Domain prediction using databases like Pfam, InterPro, and SMART

    • Transmembrane topology prediction using TMHMM or Phobius

  • Structural Prediction and Analysis:

    • 3D structure prediction using AlphaFold2 or RoseTTAFold

    • Structural comparison with proteins of known function

    • Binding site prediction for potential ligands or interaction partners

    • Molecular dynamics simulations to assess stability and potential conformational changes

  • Genomic Context Analysis:

    • Examination of genomic neighborhood for functionally related genes

    • Identification of conserved gene clusters across species

    • Analysis of co-expression patterns with genes of known function

    • Study of evolutionary patterns and selective pressure

  • Network-Based Approaches:

    • Protein-protein interaction prediction

    • Integration of multiple 'omics' data sources

    • Guilt-by-association analysis with proteins of known function

    • Pathway enrichment analysis

These computational approaches can provide testable hypotheses about YihY's function, guiding experimental design for functional characterization and potentially revealing unexpected roles within bacterial membrane biology.

What are effective strategies for generating and characterizing YihY knockout mutants?

Creating and characterizing YihY knockout mutants requires careful experimental design:

  • Knockout Generation Methods:

    • CRISPR-Cas9 system for precise gene deletion

    • Lambda Red recombination system for replacing yihY with antibiotic resistance cassette

    • Transposon mutagenesis for generating insertion mutants

    • Chromosomal point mutations to disrupt specific functional domains

  • Phenotypic Characterization:

    • Growth curve analysis under various conditions (temperature, pH, osmotic stress)

    • Membrane integrity assays using fluorescent dyes

    • Antibiotic sensitivity profiling

    • Metabolic profiling using mass spectrometry

  • Complementation Studies:

    • Expression of wild-type yihY from plasmid in knockout strain

    • Site-directed mutagenesis to identify critical residues

    • Domain-swapping experiments with related proteins

    • Cross-species complementation to assess functional conservation

  • Omics-Based Approaches:

    • Transcriptome analysis (RNA-seq) to identify compensatory responses

    • Proteome analysis to detect changes in membrane protein composition

    • Lipidomics to assess alterations in membrane lipid composition

    • Metabolomics to identify metabolic pathway disruptions

A comprehensive characterization using these approaches can reveal the physiological importance of YihY and provide insights into its functional role within the bacterial cell membrane.

How should researchers design experiments to study YihY expression under different environmental conditions?

To systematically investigate YihY expression patterns under varying environmental conditions, researchers should implement this experimental framework:

  • Reporter System Construction:

    • Create translational fusions (YihY-GFP, YihY-LacZ)

    • Design transcriptional fusions (PyihY-GFP, PyihY-LacZ)

    • Include appropriate controls with constitutive promoters

    • Validate reporter system functionality under standard conditions

  • Environmental Variables to Test:

    • Temperature ranges (4°C to 45°C)

    • pH variation (pH 5.0 to 9.0)

    • Osmotic stress (various NaCl or sucrose concentrations)

    • Nutrient limitation (carbon, nitrogen, phosphate)

    • Oxidative stress (H₂O₂, paraquat)

    • Growth phase effects (log, stationary, biofilm)

  • Quantification Methods:

    • Flow cytometry for single-cell expression analysis

    • Plate reader assays for population-level measurements

    • Quantitative RT-PCR for mRNA level assessment

    • Western blotting for protein level determination

  • Data Analysis and Interpretation:

    • Normalization to reference genes/proteins

    • Statistical analysis to identify significant changes

    • Time-course studies to capture dynamic responses

    • Mathematical modeling of regulatory networks

This systematic approach will help identify conditions that regulate YihY expression, providing clues about its physiological role and potential involvement in stress responses, similar to the desiccation stress studies conducted with other bacterial membrane proteins .

How does YihY compare structurally and functionally with other members of the BrkB/YihY/UPF0761 family?

While direct experimental data comparing YihY with other family members is limited in the provided research, a framework for comparison can be established:

FeatureYihY (UPF0761)Other BrkB/YihY Family MembersSignificance
Sequence conservationReference sequenceVariable conservation across speciesIdentifies functionally important residues
Membrane topologyMultiple transmembrane segmentsSimilar membrane integration patternsSuggests conserved structural organization
Functional annotationNot an RNase Variable annotations, often uncharacterizedEliminates one potential functional class
Genomic contextyihY locus (ECP_4095)Variable genomic neighborhoodsMay indicate species-specific functions
Structural featuresFull length: 290 amino acidsVariable length but conserved domainsHighlights core functional domains

Researchers should conduct comprehensive sequence and structural alignments to identify conserved motifs that might indicate functional sites. Heterologous expression of family members from different bacterial species could reveal functional conservation or specialization across the family.

What insights can be gained by comparing YihY with the functionally characterized YibN protein?

Although YihY and YibN are distinct proteins, comparing their properties and experimental approaches provides valuable methodological insights:

  • Interaction Partners:

    • YibN has been identified as an interactor with YidC, an essential membrane protein insertase

    • Similar proximity-dependent biotin labeling (BioID) could identify YihY interaction partners

    • Affinity purification-mass spectrometry methods used for YibN could be applied to YihY

  • Membrane Effects:

    • YibN overexpression leads to inner membrane proliferation

    • Similar phenotypic analyses could determine if YihY affects membrane structure

    • Thin-layer chromatography methods used for YibN could assess YihY's impact on lipid composition

  • Functional Assessment:

    • YibN enhances the biogenesis of certain membrane proteins

    • Similar co-expression experiments could test YihY's effect on membrane protein production

    • In vitro translation/insertion assays with inverted membrane vesicles could be adapted for YihY studies

  • Structural Determinants:

    • YibN's transmembrane segment (residues 1-29) is essential for YidC interaction

    • Similar deletion constructs could identify functional domains in YihY

    • Blue Native-PAGE analysis used for YibN-YidC could detect YihY complexes

By adapting the successful experimental approaches used to characterize YibN, researchers can develop effective strategies for investigating YihY's function and interactions within the bacterial membrane environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.