Recombinant Escherichia coli O7:K1 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O7:K1 Cardiolipin Synthase (Cls)

Escherichia coli O7:K1 Cardiolipin synthase (Cls), also known as CL synthase, is an enzyme that catalyzes the synthesis of cardiolipin (CL) . Cardiolipin is a unique anionic phospholipid predominantly found in bacterial membranes and mitochondrial inner membranes of eukaryotes . The enzyme, specified by the cls gene, facilitates the transfer of a phosphatidyl group from one phosphatidylglycerol molecule to another, forming cardiolipin and glycerol .

Functional Properties and Enzymatic Activity

E. coli cardiolipin synthase catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) and glycerol . The enzyme can also utilize various polyols such as mannitol and arabitol to convert CL to the corresponding phosphatidylglycerol analog . The activity of CL synthase can be assessed using a mixed micelle assay .

Regulation and Inhibition

The enzyme is regulated at both the genetic and enzymatic levels . CL synthase is inhibited by cardiolipin, the product of the reaction, and by phosphatidate. Phosphatidylethanolamine can partially offset the inhibition caused by cardiolipin but not by phosphatidate . CDP-diacylglycerol does not appear to directly affect the activity of the purified enzyme but may stimulate activity in crude membrane preparations .

Role in Biofilm Formation

Cardiolipin plays a crucial role in biofilm formation in E. coli . Depletion of cardiolipin can reduce biofilm formation by as much as 50% . The absence of cardiolipin activates the Rcs envelope stress response, which represses the production of flagella, disrupts initial biofilm attachment, and reduces biofilm growth .

Impact on Protein Translocation

Cardiolipin enhances protein translocation across the inner membrane . Depleting cardiolipin negatively affects Sec-mediated protein translocation in vivo, as demonstrated by decreased translocation activity of alkaline phosphatase PhoA in cells lacking CL .

Clinical Significance and Pathogenesis

E. coli K1 is a common cause of neonatal meningitis, and while cardiolipin synthase itself is not directly implicated as a virulence factor, the broader implications of cardiolipin in bacterial physiology suggest it could influence pathogenesis . Mutants lacking cls have longer doubling times, are more prone to losing viability during the stationary phase, show increased resistance to 3,4-dihydroxybutyl-1-phosphonate, and exhibit altered sensitivity to novobiocin .

Applications and Research

Recombinant E. coli O7:K1 Cardiolipin synthase is available for research purposes, typically supplied as a recombinant protein . It is useful in studies related to lipid metabolism, enzyme kinetics, and the role of cardiolipin in bacterial physiology .

Biochemical Properties

PropertyDescription
Enzyme NameCardiolipin synthase
SourceEscherichia coli O7:K1 (strain IAI39 / ExPEC)
Molecular Weight45-46 kDa (native enzyme), 54 kDa (predicted from gene sequence)
EC Number2.7.8.-
Gene Namecls
Amino Acid SequenceMTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Optimal Storage-20℃ (long-term), 4℃ (short-term, up to one week)
Expression Region1-486

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; ECIAI39_1584; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the different cardiolipin synthase genes identified in E. coli?

In E. coli, three distinct cardiolipin synthase genes have been identified: clsA (previously known as cls), clsB (previously known as ybhO), and clsC (previously known as ymdC). Each of these genes encodes a cardiolipin synthase enzyme that belongs to the phospholipase D superfamily. While all three enzymes catalyze the formation of cardiolipin, they do so through different biochemical mechanisms. ClsA and ClsB catalyze the condensation of two phosphatidylglycerol (PG) molecules to form cardiolipin and glycerol, while ClsC utilizes a different substrate combination .

How does the function of ClsC differ from ClsA and ClsB in E. coli?

ClsC employs a fundamentally different mechanism for cardiolipin synthesis compared to ClsA and ClsB. While ClsA and ClsB use two phosphatidylglycerol (PG) molecules as substrates to form cardiolipin and glycerol, ClsC uses phosphatidylethanolamine (PE) as the phosphatidyl donor to PG to form cardiolipin. This represents a third and unique mode of cardiolipin synthesis in E. coli. This distinctive substrate preference was confirmed through in vitro assays using synthetic phospholipids with defined fatty acid compositions. In these experiments, the addition of both PG and PE resulted in a 500-fold increase in the expected cardiolipin species, conclusively demonstrating that ClsC requires both PG and PE as co-substrates for cardiolipin synthesis .

What is the role of YmdB in cardiolipin synthesis by ClsC?

YmdB significantly enhances the cardiolipin synthase activity of ClsC. The ymdB gene is located in the same operon as clsC, separated by only one base pair, suggesting a functional relationship. Experimental evidence demonstrates that while expression of clsC alone in a ΔclsABC mutant results in only small, measurable amounts of cardiolipin, co-expression of ymdB and clsC produces cardiolipin levels comparable to those achieved with clsA or clsB overexpression. YmdB contains a macro domain with predicted adenosine diphosphate (ADP) ribose-binding potential, although its precise molecular mechanism in enhancing ClsC activity remains to be fully elucidated. This co-dependency highlights a complex regulatory system for ClsC-mediated cardiolipin synthesis .

How do the cardiolipin species produced by different synthases vary in composition?

The cardiolipin species produced by different cardiolipin synthases in E. coli show distinct compositional profiles. When expressed in a ΔclsABC mutant and provided with synthetic phosphatidylglycerol (PG with 17:0/14:1 acyl chains) as a substrate, ClsA produces a major cardiolipin molecule with a molecular weight consistent with the condensation of two synthetic PG molecules. Mass spectrometry analysis confirms this through detection of the [M-2H]2– ion at m/z 659.437 and fragment ions at m/z 225.187 and m/z 269.249, corresponding to C14:1 and C17:0 fatty acids respectively. In contrast, YmdB-ClsC produces a heterogeneous distribution of cardiolipin species, with major peaks at m/z 666.448 for CL(63:2), m/z 673.459 for CL(64:1), and m/z 680.464 for CL(65:2). MS/MS analysis of these species reveals fatty acids from both the synthetic PG and endogenous E. coli lipids, indicating different substrate utilization patterns between the enzymes .

What is known about the catalytic mechanism of cardiolipin synthases?

The catalytic mechanism of cardiolipin synthases involves the CDP-alcohol phosphatidyltransferase motif, particularly the conserved "DG XX AR XXXXXXXX G XXX D XXX D" sequence, which is essential for enzyme activity. This motif is highly conserved across the CRLS family proteins, including in homologues from other organisms like C. elegans . Mutation of this putative catalytic motif prevents cardiolipin formation, confirming its critical functional role. For ClsA and ClsB, the mechanism involves condensation of two PG molecules, releasing glycerol. For ClsC, the reaction utilizes PE as the phosphatidyl donor to PG, representing a mechanistically distinct pathway. The substrate specificity and catalytic efficiency of these enzymes appear to be influenced by both the core catalytic domain and potentially by interactions with other proteins, as evidenced by the enhanced activity of ClsC when co-expressed with YmdB .

How can one effectively clone and express recombinant cardiolipin synthase genes in E. coli?

For effective cloning and expression of recombinant cardiolipin synthase genes in E. coli, researchers have successfully employed the following methodological approach:

  • Vector selection: The arabinose-inducible pBAD30 vector has proven effective for controlled expression of cls genes.

  • Cloning strategy: Include ribosome-binding sites with the target gene to ensure efficient translation.

  • Growth conditions: Culture transformants to stationary phase (A600 of ~2.0) in medium containing appropriate antibiotic (e.g., ampicillin) and inducer (0.2% arabinose).

  • Multi-gene expression: When expressing multiple genes from the same operon (e.g., ymdB and clsC), maintain their natural genetic context to preserve functional interactions.

  • Expression verification: For preliminary analysis, thin-layer chromatography (TLC) with charring provides a simple visualization method, while mass spectrometry offers more detailed characterization.

This approach has successfully demonstrated functional expression of all three E. coli cardiolipin synthases, with ClsA and ClsB showing robust activity individually, while ClsC requires co-expression with YmdB for optimal function .

What analytical techniques are most effective for characterizing cardiolipin produced by recombinant synthases?

The most effective analytical techniques for characterizing cardiolipin produced by recombinant synthases involve a combination of approaches:

Analytical TechniqueApplicationKey Advantages
Thin-layer chromatography (TLC)Initial detection and semi-quantitative analysisSimple screening, suitable for comparative analysis
Silver staining of polyacrylamide gelsVisualization of lipopolysaccharides and related moleculesEffective for detecting O-side chain material
ImmunoblottingConfirmation of specific cardiolipin speciesProvides specificity when combined with appropriate antibodies
Mass spectrometry (MS)Detailed molecular characterizationIdentifies exact molecular weights and structures
Tandem MS (MS/MS)Fatty acid composition analysisReveals constituent fatty acids through fragmentation patterns
Multiple reaction monitoring (MRM)Highly selective detection of specific cardiolipin speciesFilters for both parent and fragment ions, providing high specificity

For comprehensive analysis, liquid chromatography coupled with tandem mass spectrometry (LC/MS/MS) offers the most detailed characterization, enabling researchers to identify both the molecular species of cardiolipin produced and their constituent fatty acids. This is particularly valuable when studying the substrate specificity of different cardiolipin synthases .

How can one determine the substrate specificity of different cardiolipin synthases in vitro?

To determine the substrate specificity of different cardiolipin synthases in vitro, researchers have developed a systematic approach using synthetic phospholipids with defined fatty acid compositions:

  • Enzyme preparation: Prepare membrane fractions from E. coli strains expressing the cardiolipin synthase of interest.

  • Substrate preparation: Utilize synthetic phospholipids (5 μM) with unnatural fatty acid compositions as substrates to differentiate between endogenous and exogenous fatty acids in the products.

  • Reaction conditions: Combine the enzyme preparation with various potential substrates (PG, PE, PA, CDP-DAG) individually and in combinations.

  • Product analysis: Employ multiple reaction monitoring (MRM) on a triple quadrupole mass spectrometer, where:

    • The first mass analyzer (Q1) selects for the expected [M-2H]2– ion of the cardiolipin product

    • After collision-induced dissociation, the last mass analyzer (Q3) isolates specific fatty acid anions

  • Specificity confirmation: Compare signal intensities across different substrate combinations to identify required co-substrates.

Using this methodology, researchers determined that ClsC specifically requires both PG and PE as substrates, evidenced by a 500-fold increase in signal when both were present compared to individual substrates or other combinations .

How can researchers interpret heterogeneous cardiolipin species in mass spectrometry data?

Interpreting heterogeneous cardiolipin species in mass spectrometry data requires a systematic analytical approach:

  • Primary ion analysis: Identify the m/z values of the major peaks in the mass spectrum, typically appearing as doubly charged [M-2H]2– ions for cardiolipin molecules.

  • Molecular formula assignment: Calculate the total number of carbons and double bonds from each m/z value, such as CL(63:2) at m/z 666.448, CL(64:1) at m/z 673.459, and CL(65:2) at m/z 680.464.

  • Fragmentation pattern analysis: Perform MS/MS to generate fragment ions that correspond to individual fatty acid carboxylate anions:

    • m/z 225.193 indicates C14:1 fatty acid

    • m/z 269.258 indicates C17:0 fatty acid

    • m/z 255.245 indicates C16:0 fatty acid (common in endogenous E. coli lipids)

    • m/z 253.228 indicates C16:1 fatty acid (common in endogenous E. coli lipids)

  • Source determination: Establish whether fatty acids originate from exogenous synthetic substrates or endogenous E. coli lipids based on their characteristic masses.

  • Biological significance assessment: Heterogeneity may indicate:

    • Promiscuous substrate utilization by the enzyme

    • Post-synthetic remodeling of cardiolipin

    • Different catalytic mechanisms between enzymes (e.g., ClsA produces more homogeneous products than YmdB-ClsC)

This analytical framework provides insights into enzyme mechanisms, substrate preferences, and potential physiological implications of different cardiolipin species .

What controls and validation methods are essential when characterizing novel cardiolipin synthase activities?

When characterizing novel cardiolipin synthase activities, several essential controls and validation methods should be implemented:

  • Genetic controls:

    • Single, double, and triple knockout strains (e.g., ΔclsA, ΔclsAB, ΔclsABC)

    • Complementation with individual cls genes to confirm specificity of phenotypes

    • Mutation of putative catalytic motifs to confirm enzymatic mechanism

  • Biochemical controls:

    • Inclusion of synthetic substrates with defined fatty acid compositions

    • Comparison of reaction products with standards of known composition

    • Testing of multiple substrate combinations to establish specificity

  • Analytical validation:

    • Multiple detection methods (TLC, MS, immunoblotting)

    • MS/MS confirmation of cardiolipin identity through fatty acid composition

    • Multiple reaction monitoring (MRM) for specific and sensitive detection

  • Functional validation:

    • Assessment of growth phase-dependent activity

    • Evaluation of environmental influences (osmolarity, temperature)

    • Correlation of enzyme activity with physiological effects

By implementing these controls and validation methods, researchers can confidently characterize novel cardiolipin synthase activities while minimizing false positives and ensuring reproducibility across experimental conditions .

How do environmental factors influence cardiolipin synthase expression and activity in E. coli?

Environmental factors significantly influence cardiolipin synthase expression and activity in E. coli, as demonstrated by several key observations:

  • Growth phase effects:

    • In stationary phase, expression of either clsA or clsB can restore cardiolipin to near wild-type levels in a ΔclsABC mutant

    • ClsC provides only low levels of cardiolipin in stationary phase when expressed alone, but near wild-type levels when co-expressed with ymdB

  • Osmotic regulation:

    • All three cardiolipin synthases (ClsA, ClsB, and ClsC) show increased activity with rising medium osmolarity

    • This response occurs during both logarithmic growth and stationary phase

    • The relationship between osmolarity and cardiolipin synthesis suggests a role in adapting membrane properties to osmotic stress

  • Substrate availability influence:

    • Only ClsA contributes detectable levels of cardiolipin at low osmolarity during logarithmic growth

    • The differential substrate requirements of the three synthases (ClsA/B using PG-PG, ClsC using PE-PG) may provide metabolic flexibility under conditions where one substrate becomes limiting

  • Regulatory coordination:

    • The coordinated expression of ymdB and clsC from the same operon suggests sophisticated regulatory mechanisms

    • The one base pair separation between these genes indicates tight transcriptional coupling

These patterns of environmental responsiveness suggest that E. coli has evolved multiple cardiolipin synthases with distinct regulatory properties to maintain appropriate membrane composition across diverse environmental conditions .

How can recombinant cardiolipin synthase systems contribute to understanding bacterial membrane adaptation?

Recombinant cardiolipin synthase systems provide powerful tools for investigating bacterial membrane adaptation through several research approaches:

  • Controlled expression studies: By expressing individual cls genes in a ΔclsABC background, researchers can isolate the contribution of each synthase to membrane composition under defined conditions.

  • Substrate manipulation experiments: Using synthetic phospholipids with defined fatty acid compositions allows precise tracking of lipid metabolism and membrane remodeling processes.

  • Environmental stress response analysis: Recombinant systems permit assessment of how different cardiolipin synthases respond to environmental stressors, including:

    • Osmotic stress (where all three synthases show increased activity)

    • Growth phase transitions (where ClsA and ClsB show high activity in stationary phase)

    • Nutrient limitation (potentially affecting substrate availability)

  • Membrane biophysics investigations: Controlled production of specific cardiolipin species facilitates studies on how lipid composition affects membrane properties such as fluidity, curvature, and protein interaction.

These approaches collectively enhance our understanding of how bacteria modulate their membrane composition to maintain cellular function across changing environments, with implications for basic microbiology and potential antimicrobial development strategies .

What are the current limitations in our understanding of cardiolipin synthase regulation in E. coli?

Despite significant advances, several important limitations remain in our understanding of cardiolipin synthase regulation in E. coli:

  • Transcriptional regulation mechanisms:

    • The specific transcription factors controlling cls gene expression remain poorly characterized

    • The promoter elements and regulatory sequences for each cls gene require further elucidation

    • How environmental signals are transduced to alter cls gene expression is not fully understood

  • Post-translational regulation:

    • Potential protein modifications affecting enzyme activity have not been systematically investigated

    • The precise molecular mechanism by which YmdB enhances ClsC activity remains unknown

    • Whether cardiolipin synthases form functional complexes with other membrane proteins is unclear

  • Metabolic integration:

    • How cardiolipin synthesis coordinates with broader phospholipid metabolism networks is incompletely characterized

    • The mechanisms sensing phospholipid substrate availability and regulating synthase activity accordingly remain obscure

    • The fate of glycerol released during ClsA/ClsB-mediated cardiolipin synthesis and its potential metabolic recycling requires investigation

  • Physiological significance:

    • The specific physiological advantages of maintaining three distinct cardiolipin synthases with different substrate preferences require further clarification

    • The cellular consequences of altered cardiolipin composition under different stress conditions need more detailed characterization

Addressing these limitations will enhance our understanding of the sophisticated regulatory networks governing bacterial membrane composition .

What potential biotechnological applications could emerge from research on recombinant cardiolipin synthases?

Research on recombinant cardiolipin synthases could enable several promising biotechnological applications:

Application AreaPotential DevelopmentScientific Basis
Membrane engineeringCreation of bacteria with customized membrane compositionsDifferential expression of specific cls genes produces distinct cardiolipin profiles
Biofuel productionEnhanced microbial tolerance to organic solventsCardiolipin influences membrane stability under stress conditions
Phospholipid bioproductionEnzymatic synthesis of defined cardiolipin speciesClsA produces relatively homogeneous cardiolipin when provided with defined substrates
Antimicrobial developmentNovel therapeutics targeting cardiolipin biosynthesisEssential role of cardiolipin in bacterial membrane function
BiosensorsStress-responsive reporter systemsGrowth phase and osmolarity-dependent regulation of cls genes
Protein expression optimizationImproved membrane protein productionCardiolipin's role in supporting membrane protein function

The unique substrate specificities of the three E. coli cardiolipin synthases offer particularly valuable tools for these applications. ClsA and ClsB utilize two PG molecules, while the ClsC-YmdB system employs PE and PG as co-substrates, providing complementary approaches for membrane engineering. Additionally, the differential regulation of these enzymes by environmental conditions could be exploited to create responsive biosystems with tunable membrane properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.