Recombinant Escherichia coli O7:K1 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Role in Cobalamin Biosynthesis

CobS catalyzes the transfer of α-ribazole-5′-phosphate to adenosylcobinamide-GDP, forming adenosylcobalamin-5′-phosphate (AdoCbl-5′-P), a key intermediate in vitamin B12 biosynthesis .

Key Reactions:

  • Substrates: Adenosylcobinamide-GDP + α-ribazole-5′-P

  • Product: Adenosylcobalamin-5′-P

  • Cofactors: Mg²⁺ (required for enzymatic activity)

In Salmonella typhimurium, CobS works with CobU and CobT to assemble the nucleotide loop of cobalamin . The final dephosphorylation to adenosylcobalamin is mediated by CobC .

3.1. In Vitro Activity

  • CobS synthesizes AdoCbl-5′-P at pH 9.0 with a catalytic efficiency of 1.2 nmol/min/mg protein .

  • Purified His-tagged CobS retains activity in Tris/PBS buffer with 50 mM MgCl₂ .

3.2. Overexpression Challenges

  • Elevated CobS levels in E. coli disrupt the proton motive force (PMF), leading to membrane instability and cell death .

  • Coexpression with CobC (phosphatase) or PspA (phage shock protein) mitigates PMF dissipation and improves viability .

Applications in Metabolic Engineering

Recombinant CobS enables E. coli to produce vitamin B12 via engineered pathways:

4.1. Pathway Optimization

  • Rhodobacter capsulatus genes (bluE, cobC) were integrated into E. coli to synthesize (R)-1-amino-2-propanol O-2-phosphate, a cobalamin precursor .

  • Coexpression with cobalt chelatases (e.g., cobN, cobT) increased B12 yields to 307 µg/g DCW .

4.2. Industrial Production

  • Recombinant CobS is used in microbial platforms for large-scale B12 production, avoiding reliance on chemical synthesis .

Research Challenges

  • Cobalt Dependency: Aerobic pathways require late cobalt insertion, complicating enzyme coordination .

  • Enzyme Stability: CobS requires glycerol (5–50%) for long-term storage at -80°C .

Comparative Analysis of cobS Homologs

OrganismFunctionCofactor
Salmonella typhimuriumAnaerobic cobalamin synthase Mg²⁺
Rhodobacter capsulatusAerobic pathway enzyme None
Escherichia coli O7:K1Recombinant His-tagged variant Mg²⁺

Future Directions

  • Structural Studies: Elucidate CobS’s 3D structure to improve catalytic efficiency .

  • Synthetic Biology: Integrate CobS into minimal genomes for streamlined B12 production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format requirement, please indicate it in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly equipped with blue ice packs. If dry ice packaging is required, please inform us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing it for your product.
Synonyms
cobS; ECIAI39_1055; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIEFGEL VFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and alpha-ribazole. It also produces adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the specific role of CobS in the cobalamin biosynthetic pathway?

CobS functions as an essential component of the cobaltochelatase complex in the aerobic pathway of vitamin B12 biosynthesis. It works in conjunction with CobN and CobT to form the CobNST complex, which is responsible for the insertion of cobalt(II) into hydrogenobyrinic acid a,c-diamide during the late stages of cobalamin synthesis . Unlike the anaerobic pathway where cobalt is inserted early by enzymes like CbiK, the aerobic pathway employs CobS as part of this specialized complex that inserts cobalt after much of the corrin ring structure has been assembled . This timing difference represents a fundamental distinction between aerobic and anaerobic cobalamin biosynthesis strategies.

What are the essential cofactors and reaction conditions for CobS activity?

CobS activity requires specific cofactors and conditions for optimal function. ATP serves as an essential energy source for the cobalt insertion reaction, with magnesium ions acting as critical cofactors for ATP binding and hydrolysis. The enzyme functions optimally at pH 7.5-8.0 under aerobic conditions, reflecting its role in the oxygen-dependent pathway of cobalamin biosynthesis . Reducing conditions help maintain the correct redox state of catalytic cysteine residues that may be involved in cobalt handling. Temperature sensitivity analyses typically show optimal activity around 30-37°C, though this can vary based on the source organism and experimental conditions.

What expression systems yield the highest activity for recombinant E. coli O7:K1 CobS?

For optimal expression of functional E. coli O7:K1 CobS, several systems have proven effective, each with distinct advantages. BL21(DE3) strains lacking lon and ompT proteases provide high-level expression when combined with T7 promoter-based vectors like pET systems. Expression at reduced temperatures (16-20°C) substantially improves solubility compared to standard 37°C conditions. Co-expression with molecular chaperones (GroEL/GroES system) can significantly enhance proper folding. For challenging cases, fusion partners like maltose-binding protein (MBP) or SUMO can dramatically improve solubility while maintaining activity. Co-expression with CobN and CobT partners often yields the highest specific activity, as the proteins may stabilize each other through complex formation.

What purification strategy preserves CobS activity while achieving high purity?

A successful purification strategy for CobS must balance yield, purity, and retention of enzymatic activity. A recommended approach involves initial capture via immobilized metal affinity chromatography (IMAC) using a histidine tag, followed by size exclusion chromatography to separate monomeric/oligomeric forms and remove aggregates. Throughout purification, buffers should contain stabilizing components including:

Buffer ComponentConcentrationPurpose
Tris-HCl (pH 8.0)50 mMpH maintenance
NaCl100-200 mMIonic strength
Glycerol10-20%Stability enhancement
DTT or β-mercaptoethanol1-5 mMReducing environment
MgCl₂5 mMCofactor stabilization
ATP0.1-0.5 mMActive site stabilization

This protocol typically yields >90% pure protein with activity retention above 70% of the theoretical maximum.

How can researchers overcome inclusion body formation when expressing CobS?

Inclusion body formation represents a common challenge when expressing recombinant CobS. Several strategies can address this issue effectively. Lowering induction temperature to 16-18°C and reducing IPTG concentration to 0.1-0.3 mM dramatically decreases inclusion body formation. Expressing CobS as a fusion with solubility-enhancing partners like MBP, GST, or SUMO can significantly improve proper folding. Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE systems) assists protein folding pathways. For stubborn cases, specialized E. coli strains like Arctic Express or SHuffle, which express cold-adapted chaperones or enhance disulfide bond formation respectively, can provide substantial improvement in soluble yield.

What experimental approaches are most effective for studying CobS structure-function relationships?

Understanding CobS structure-function relationships requires integrating multiple experimental approaches. X-ray crystallography provides high-resolution static structures, ideally with various ligands to capture different functional states. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) identifies flexible regions and conformational changes upon substrate binding or complex formation. Site-directed mutagenesis of conserved residues, particularly in the ATP-binding Walker motifs and predicted metal coordination sites, followed by activity assays, establishes the functional importance of specific amino acids. Protein-protein interaction studies using techniques like surface plasmon resonance (SPR) quantify binding parameters between CobS and its partners in the cobaltochelatase complex. Molecular dynamics simulations complement experimental data by predicting conformational changes and energy landscapes during the catalytic cycle.

How does CobS interact with other components of the cobaltochelatase complex?

CobS functions as part of the tripartite CobNST cobaltochelatase complex, with each component playing a distinct role in cobalt insertion . CobN (~140 kDa) forms the largest component and likely binds the hydrogenobyrinic acid a,c-diamide substrate. CobS (~40 kDa) provides ATP-binding and hydrolysis functionality essential for energizing the cobalt insertion reaction. CobT (~30 kDa) appears to serve as an adaptor that stabilizes the complex architecture. The assembly of this complex follows an ordered pathway, with specific interaction interfaces between components. Optimal complex formation requires precise stoichiometric ratios of the three proteins, typically approaching 1:1:1, though slight deviations can occur depending on experimental conditions and the specific organism studied.

What spectroscopic methods can monitor CobS-mediated cobalt insertion?

Several spectroscopic techniques provide valuable insights into CobS-mediated cobalt insertion. UV-visible spectroscopy offers the most direct approach, as cobalt insertion into hydrogenobyrinic acid a,c-diamide generates characteristic spectral shifts with decreased absorbance at 385-395 nm and increased absorbance at 410-420 nm. Circular dichroism spectroscopy monitors both secondary structure integrity and substrate binding-induced conformational changes. Fluorescence spectroscopy using intrinsic tryptophan fluorescence or extrinsic probes can track protein conformational changes during catalysis. For advanced studies, electron paramagnetic resonance (EPR) spectroscopy provides detailed information about the cobalt center, particularly the Co(II) oxidation state. Resonance Raman spectroscopy offers complementary data about metal-ligand vibrations within the corrin ring structure.

How can researchers use CobS to compare aerobic and anaerobic cobalamin biosynthesis pathways?

Recombinant CobS serves as an excellent tool for comparative studies between aerobic and anaerobic cobalamin biosynthesis pathways. The fundamental difference lies in cobalt insertion timing - in the aerobic pathway, CobS functions in the CobNST complex to insert cobalt late in the synthesis after ring contraction, while in the anaerobic pathway, enzymes like CbiK insert cobalt early into sirohydrochlorin . Researchers can design experiments comparing ATP requirements between pathways, as the CobNST complex requires ATP hydrolysis while CbiK operates in an ATP-independent manner . Oxygen dependency studies reveal how the aerobic pathway utilizes molecular oxygen for ring contraction steps that precede CobS action. Hybrid pathway reconstruction experiments combining CobS with anaerobic pathway enzymes provide insights into evolutionary relationships and potential biotechnological applications.

What methodological approaches are best for studying the ATP-dependent mechanism of CobS?

Investigating the ATP-dependent mechanism of CobS requires specialized methodological approaches. Isothermal titration calorimetry (ITC) provides thermodynamic parameters of ATP binding, including binding constants, stoichiometry, enthalpy, and entropy changes. Enzyme kinetic studies using coupled spectrophotometric assays link ATP hydrolysis to NADH oxidation for real-time monitoring of reaction rates. ATP analogs (non-hydrolyzable AMP-PNP or slowly-hydrolyzable ATP-γ-S) help distinguish between binding and hydrolysis requirements. 31P-NMR spectroscopy tracks ATP hydrolysis directly by monitoring phosphate release patterns. Site-directed mutagenesis targeting the Walker A and B motifs, followed by kinetic analysis, establishes the roles of specific residues in ATP binding and hydrolysis. These approaches collectively elucidate how ATP binding and hydrolysis couple to the cobalt insertion reaction.

How can researchers develop assays to measure the cobaltochelatase activity of the CobNST complex?

Developing robust assays for the cobaltochelatase activity of the CobNST complex requires careful consideration of several factors. Direct spectrophotometric assays monitoring the conversion of hydrogenobyrinic acid a,c-diamide to the cobalt-inserted product capitalize on the characteristic spectral shifts (decreased absorbance at 385-395 nm, increased at 410-420 nm). HPLC-based separation with UV-visible detection provides more specific quantification of substrate consumption and product formation with typical chromatographic parameters including:

ParameterTypical ConditionPurpose
ColumnC18 reverse phaseSeparation of tetrapyrrole compounds
Mobile phaseMethanol/water/acetic acid gradientOptimal resolution
Flow rate1.0 mL/minBalance of resolution and run time
Detection wavelength361 nm and 417 nmSubstrate and product maxima
Injection volume20-50 μLSensitivity vs. column capacity

Radioisotopic assays using 57Co provide exceptional sensitivity for product formation, while coupled enzyme assays linking ATP hydrolysis to spectrophotometric indicators offer an alternative approach when purified substrate availability is limited.

How can researchers address metal specificity issues when studying CobS?

Metal specificity challenges in CobS research require systematic approaches to ensure proper metallation. During expression, supplementing growth media with cobalt chloride (50-100 μM) improves the correct metallation state of CobS. All buffers used during purification should be prepared with high-purity water and chemicals to minimize metal contamination. Treating protein samples with careful chelation using EDTA followed by dialysis and reintroduction of specific metals can reset the metallation state. Metal specificity assays comparing activity with various metals (Co2+, Ni2+, Zn2+, Fe2+) help characterize the enzyme's natural preferences. Inductively coupled plasma mass spectrometry (ICP-MS) provides quantitative analysis of metal content in purified protein preparations. Site-directed mutagenesis of predicted metal-coordinating residues can identify the specific amino acids involved in metal binding and selectivity.

What strategies help overcome substrate limitations in CobS research?

The limited availability of the natural substrate, hydrogenobyrinic acid a,c-diamide, presents a significant challenge in CobS research. Several strategies can address this limitation effectively. Establishing collaboration with specialized laboratories that synthesize tetrapyrrole intermediates provides access to authentic substrates. Developing synthetic substrate analogs with simplified structures that retain key recognition elements expands experimental options. Implementing enzymatic synthesis pathways using recombinant upstream enzymes (CobA through CobH) to generate substrates in situ creates a renewable source. Metabolic engineering of tetrapyrrole-producing bacterial strains for enhanced precursor production increases yield. Miniaturizing assay formats to reduce substrate requirements per experiment maximizes data generation from limited substrate stocks. For advanced studies, enzymatic or chemical derivatization of more readily available precursors (like uroporphyrinogen III) creates functional substrate analogs.

How should researchers interpret contradictory results from different CobS activity assays?

When faced with contradictory results from different CobS activity assays, researchers should implement a systematic troubleshooting approach. Begin by comparing the detection principles of each assay - direct product detection methods (spectrophotometric, HPLC) measure cobalt insertion specifically, while indirect methods (ATP hydrolysis) may detect uncoupled activity. Verify enzyme quality across experiments through consistent expression and purification protocols, as batch-to-batch variation can significantly impact results. Standardize reaction conditions including buffer composition, pH, temperature, and metal ion concentrations across all assay platforms. Conduct time-course experiments to ensure measurements occur in the linear range of each assay. Consider substrate quality and purity, as degradation products may inhibit activity or generate false signals. Validate results using orthogonal methods - when spectrophotometric and HPLC-based methods yield different results, adding mass spectrometry analysis can provide definitive answers about product identity and quantity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.