Recombinant Escherichia coli O7:K1 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Biosynthesis and Expression

Recombinant RnfE is produced via heterologous expression in E. coli systems. Key protocols include:

  • Expression Vector: Cloned into plasmids under T7/lacUV5 promoters, often using BL21(DE3) strains for high-yield production .

  • Purification: Affinity chromatography (Ni-NTA) leveraging the His tag, yielding >85% purity (SDS-PAGE verified) .

  • Storage: Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability .

Functional Role in Electron Transport

The Rnf complex, including RnfE, facilitates energy conservation by linking ferredoxin and NADH pools . In E. coli O7:K1:

  • Mechanism: Translocates ions (Na+/H+) across membranes, generating a proton motive force for ATP synthesis .

  • Genetic Context: Co-transcribed with oxidative repair gene nth in some configurations .

Research Applications

Recombinant RnfE is utilized in:

  • Immunoassays: ELISA and Western blotting for detecting RnfE in bacterial lysates .

  • Structural Studies: Investigating interactions within the Rnf complex (e.g., co-immunoprecipitation with RnfB and RnfC subunits) .

  • Metabolic Engineering: Modulating electron flux in synthetic biology applications .

Evolutionary and Comparative Insights

  • Homologs: RnfE homologs exist in Salmonella arizonae, Azotobacter vinelandii, and other bacteria, underscoring its conserved role in redox balancing .

  • Synteny: In E. coli O7:K1, the rnf operon’s chromosomal location and co-expression with stress-response genes suggest adaptive advantages under anaerobic conditions .

Challenges and Future Directions

  • Expression Optimization: Codon bias and inclusion body formation remain hurdles, addressed via engineered E. coli strains (e.g., SHuffle® T7 with disulfide isomerase DsbC) .

  • Therapeutic Potential: While RnfE itself is not a direct drug target, understanding Rnf complex dynamics could inform strategies against antibiotic-resistant pathogens .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag.
Synonyms
rsxE; ECIAI39_1424; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRLEIFHTD SPFLLAMLPPSAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex responsible for coupling electron transfer with ion translocation across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant RnfE production in E. coli?

For optimal expression of RnfE, a membrane-associated electron transport protein, the T7 promoter-based expression system remains the gold standard. The pET expression system featuring the T7 promoter is particularly effective as it enables protein accumulation of up to 50% of total cellular proteins under optimal conditions . When expressing RnfE, consider the following key factors:

  • T7 RNA polymerase-based systems allow for controlled and high-level expression when induced with IPTG

  • Expression is tightly regulated through LacI binding to the lac operator, which is inhibited upon IPTG addition

  • This inhibition allows T7 polymerase expression, which then transcribes the target gene and leads to recombinant protein production

For membrane proteins like RnfE that may exhibit toxicity upon overexpression, tunable expression systems are particularly valuable. Consider using BL21(DE3)pLysS strain containing the pLysS plasmid that produces T7 lysozyme to reduce basal expression levels, making it suitable for potentially toxic membrane proteins .

Which E. coli strains are most suitable for RnfE expression and what are their key characteristics?

When expressing membrane proteins like RnfE from the electron transport complex, strain selection is critical. BL21 and its derivatives represent the most widely used strains, each with specific advantages for membrane protein expression:

StrainKey FeaturesBest Application for RnfE Research
BL21(DE3)Deficient in Lon and OmpT proteases; contains T7 RNA polymerase geneStandard initial expression attempt
C41(DE3)/C43(DE3)Selected mutants from BL21(DE3) with mutations in lacUV5 promoterSpecifically effective for toxic and membrane proteins like RnfE
Lemo21(DE3)Contains pLemo plasmid allowing tunable expressionIdeal for difficult membrane proteins where expression level tuning may result in more properly folded protein
BL21Star(DE3)Contains mutation in rne gene for increased mRNA stabilityWhen RnfE expression is low due to mRNA instability

For RnfE specifically, C41(DE3) or C43(DE3) strains should be considered first-line options as they were specifically developed for membrane protein expression and show reduced toxicity effects. Lemo21(DE3) offers an additional advantage of fine-tuned expression control, which is particularly valuable when optimizing conditions for functional RnfE production .

How does the E. coli K1 capsule influence recombinant protein expression and experimental design?

The K1 capsule, present in approximately 25% of E. coli isolates from bloodstream infections, presents unique considerations when expressing recombinant proteins like RnfE . The presence of this capsule affects:

  • Cell membrane properties and permeability, potentially altering protein insertion efficiency

  • Cellular stress responses that may interfere with heterologous protein expression

  • Downstream purification processes due to the highly negatively charged polysialic acid composition of the K1 capsule

Research demonstrates that the K1 capsule enhances E. coli survival in human serum independent of genetic background . This protective effect could potentially interfere with cell lysis procedures during protein purification. When designing RnfE expression experiments in K1-positive strains, incorporate additional steps to effectively disrupt the capsule layer, such as extended sonication times or specialized lysis buffers.

For comparative studies, consider expressing RnfE in both K1-positive and K1-negative backgrounds to evaluate how capsular structures impact membrane protein integration and function. This approach provides valuable insights into the native functionality of RnfE within its biological context.

What strategies can optimize mRNA folding and codon usage for enhanced RnfE expression?

Optimizing the 5' coding region is critical for successful RnfE expression in E. coli. Research indicates that mRNA folding at the 5' end significantly impacts translation efficiency . Implement these evidence-based strategies:

  • Focus on the first 18 nucleotides of the coding sequence, as this region strongly influences expression levels. Specifically:

    • Increase adenine (A) content to enhance expression probability

    • Reduce guanine (G) content which tends to decrease expression

    • Use cytosine (C) and uracil (U) strategically for intermediate effects

  • Minimize mRNA secondary structure formation around the ribosome binding site by:

    • Optimizing AT-content of N-terminal codons

    • Maximizing folding energy (minimizing folding stability) in the 5' coding region

  • For RnfE specifically, which may contain rare codons, use computational tools like:

    • ExEnSo (Expression Enhancer Software)

    • RBS Calculator

    • UTR Designer

    • EMOPEC

When designing constructs, rare codons at the 5' coding region can actually increase protein expression in E. coli by approximately 14-fold (median 4-fold) . This counterintuitive approach should be considered when traditional optimization methods fail. Alternatively, express RnfE in specialized strains like BL21-CodonPlus(DE3)-RIPL or Rosetta(DE3), which provide additional copies of rare tRNA genes .

What purification approaches are most effective for maintaining RnfE structural integrity?

Purifying membrane-associated electron transport proteins like RnfE requires specialized approaches to maintain structural and functional integrity. Consider these methodological strategies:

  • Membrane protein extraction:

    • Use mild detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for initial solubilization

    • Employ a two-step extraction process with increasing detergent concentrations to improve yield

    • Consider nanodiscs or amphipols for stabilizing RnfE in a native-like membrane environment

  • Affinity-based purification:

    • Implement short affinity tags (His6 or Strep-tag II) at either N- or C-terminus depending on membrane topology predictions

    • Ensure tag placement doesn't interfere with membrane insertion or complex formation

    • Include protease inhibitors throughout purification to prevent degradation

  • Quality assessment:

    • Verify proper folding through circular dichroism spectroscopy

    • Assess oligomeric state using size exclusion chromatography

    • Confirm functional integrity through activity assays specific to electron transport

When working with E. coli O7:K1 strains, the K1 capsule may complicate cell lysis and initial purification steps. Consider enzymatic treatments to degrade capsular material prior to membrane protein extraction to improve accessibility and yield.

How can researchers achieve necessary post-translational modifications of RnfE in E. coli expression systems?

While E. coli has traditionally been limited in its ability to perform post-translational modifications, advanced genetic engineering approaches now enable various modifications crucial for RnfE functionality. For functional electron transport proteins like RnfE that may require specific modifications, implement these sophisticated approaches:

  • Phosphorylation: Co-express RnfE with appropriate kinases to achieve site-specific phosphorylation. This has been successfully demonstrated by co-expressing human proteins with Jun N-terminal kinase 1 in E. coli systems . For RnfE:

    • Identify potential phosphorylation sites through bioinformatic prediction tools

    • Clone and co-express the corresponding kinase genes in compatible vectors

    • Verify phosphorylation through mass spectrometry and phospho-specific antibodies

  • Membrane protein targeting: Ensure proper membrane insertion by co-expressing components of the signal recognition particle (SRP)/secretory (Sec) pathway . This approach includes:

    • Co-expression of FtsY (SRP receptor) to enhance membrane targeting

    • Supplementation with SecA and ATP to drive translocation

    • Addition of the SecDFYajC complex to improve biogenesis and folding

  • For more complex modifications:

    • Methylation can be achieved by co-expressing appropriate methyltransferases

    • Acetylation is possible through co-expression of specific acetylases

    • Other modifications may require dedicated enzymes from diverse organisms

When designing co-expression systems, consider using compatible plasmids with different origins of replication and complementary antibiotic selection markers. The pET system combined with pACYC vectors offers a well-established approach for simultaneous expression of multiple proteins in E. coli.

What approaches can overcome toxicity challenges when expressing RnfE in E. coli?

Membrane proteins like RnfE often exhibit toxicity upon induction in E. coli, resulting in low yields of properly folded protein . To overcome these challenges, implement these advanced strategies:

  • Tune transcription and translation rates:

    • Use lower cultivation temperatures (16-25°C) to slow folding and reduce aggregation

    • Implement weaker promoters or lower inducer concentrations to prevent saturation of membrane insertion machinery

    • Consider auto-induction media for gradual protein expression rather than sudden induction shock

  • Co-express biogenesis factors:

    • Introduce the components of the SRP/Sec pathway to enhance membrane protein targeting and insertion

    • Add specialized chaperones that facilitate membrane protein folding

    • Express the SecDFYajC complex which plays a critical role in the biogenesis, translocation, and folding of membrane proteins

  • Utilize specialized E. coli strains:

    • C41(DE3) and C43(DE3) strains harbor mutations in the lacUV5 promoter that make them particularly effective for toxic and membrane proteins

    • Lemo21(DE3) strain allows for tunable expression of difficult clones through T7 lysozyme regulation

    • Walker strains (C41/C43) have been specifically selected for their ability to tolerate membrane protein overexpression

  • Implement advanced vector systems:

    • Use vectors with tightly controlled, tunable promoters like the rhamnose promoter

    • Consider dual-vector systems where one vector produces components to prepare the cell for expression before the second vector expresses RnfE

    • Employ vectors with low copy numbers to reduce expression burden

When expressed in E. coli O7:K1 strains, consider how the K1 capsule's presence might affect cellular stress responses and modify your approach accordingly. The K1 capsule has been shown to enhance E. coli survival under stress conditions , which might provide some protective benefits when expressing potentially toxic membrane proteins.

How do genetic modifications to the RnfE gene affect protein structure-function relationships?

Understanding the structure-function relationships in RnfE requires systematic genetic modifications combined with functional assays. Implement this methodological framework:

  • Domain-based mutational analysis:

    • Identify conserved domains through sequence alignments across bacterial species

    • Create a library of domain deletions, substitutions, and chimeric constructs

    • Express modified proteins and assess membrane integration via cell fractionation

  • Site-directed mutagenesis of catalytic and structural residues:

    • Focus on predicted electron transfer residues (typically histidine, cysteine, or methionine)

    • Create alanine-scanning libraries of transmembrane regions

    • Employ cysteine-scanning mutagenesis coupled with accessibility assays to map topology

  • Assess functional consequences through:

    • Electron transfer assays using artificial electron acceptors

    • Membrane potential measurements using voltage-sensitive dyes

    • Growth complementation studies in Rnf-deficient strains

  • Advanced structural analysis:

    • Use crosslinking studies to identify interaction partners within the complex

    • Implement hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Consider cryo-electron microscopy for structural determination if expression yields permit

When working with E. coli O7:K1 strains, note that the K1 capsule has emerged independently in multiple extraintestinal pathogenic E. coli lineages , suggesting possible interactions between capsular structures and membrane processes that may influence RnfE function in different genetic backgrounds.

What are the evolutionary implications of RnfE conservation across E. coli strains and how does this inform functional studies?

The evolutionary history of RnfE provides crucial context for functional investigations. Current evolutionary data on E. coli K1 strains provides a framework for analyzing RnfE conservation and adaptation:

  • Phylogenetic distribution analysis:

    • The K1 capsule locus has emerged in at least four different extraintestinal pathogenic E. coli (ExPEC) phylogroups independently within the last 500 years

    • Similarly, analyze RnfE distribution across the E. coli phylogeny to identify patterns of conservation, loss, or acquisition

    • Compare sequence conservation in RnfE between strains with different capsular types

  • Selective pressure analysis:

    • Calculate dN/dS ratios (ratio of non-synonymous to synonymous substitutions) across RnfE sequences to identify regions under positive selection

    • Correlate adaptive changes with ecological niches or pathogenic potential

    • Identify co-evolutionary patterns between RnfE and other components of the electron transport chain

  • Functional implications:

    • Determine if RnfE variants correlate with different metabolic capabilities across E. coli lineages

    • Assess whether RnfE conservation patterns correspond to virulence potential, particularly in K1-positive strains

    • Test functional complementation between RnfE variants from diverse E. coli backgrounds

  • Experimental validation:

    • Construct chimeric RnfE proteins incorporating domains from different evolutionary variants

    • Express RnfE variants in a common genetic background to assess functional differences

    • Perform competition assays between strains with different RnfE variants under various growth conditions

The K1 capsule enhances E. coli survival in human serum independent of genetic background , suggesting potential interactions between capsular structures and membrane processes that might influence RnfE function. Investigating whether similar cross-strain functional conservation exists for RnfE would provide valuable insights into its fundamental role in bacterial physiology.

How can advanced imaging techniques be optimized for visualizing RnfE localization and dynamics in E. coli O7:K1?

Visualizing membrane protein organization and dynamics requires specialized techniques, particularly in encapsulated bacteria like E. coli O7:K1. Implement these advanced imaging approaches:

  • Fluorescent protein fusion strategies:

    • Create RnfE fusions with monomeric fluorescent proteins optimized for bacterial expression (msfGFP, mCherry)

    • Validate fusion protein functionality through complementation assays

    • Use sandwich fusions where the fluorescent tag is inserted into permissive loops rather than terminal fusions

  • Super-resolution microscopy optimization:

    • Implement photo-activated localization microscopy (PALM) or stochastic optical reconstruction microscopy (STORM)

    • For E. coli O7:K1, develop capsule penetration protocols through mild enzymatic treatment

    • Use dual-color imaging to simultaneously visualize RnfE and other complex components

  • Live-cell dynamics analysis:

    • Implement fluorescence recovery after photobleaching (FRAP) to measure RnfE mobility

    • Use fluorescence correlation spectroscopy (FCS) to quantify diffusion coefficients

    • Develop single-particle tracking protocols specific to the challenges of encapsulated bacteria

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging with cryo-electron tomography

    • Develop specialized sample preparation protocols that preserve both capsular structure and membrane protein organization

    • Implement metal-tagging approaches (APEX2 fusion) for electron microscopy contrast enhancement

When working with E. coli O7:K1, the K1 capsule may interfere with imaging clarity. Consider implementing capsule-specific labeling with fluorescent lectins or antibodies to provide context for RnfE visualization and to differentiate between membrane-associated and capsule-associated signals. This dual-visualization approach provides valuable insights into the spatial relationship between RnfE and the protective capsular structure.

What are the most common challenges in RnfE expression and how can they be systematically addressed?

Expression of membrane proteins like RnfE presents several recurring challenges. Address these methodically:

  • Low expression yields:

    • Systematically test multiple promoter strengths (T7, trc, arabinose)

    • Optimize induction conditions (temperature, inducer concentration, induction time)

    • Try expression in specialized strains like C41(DE3)/C43(DE3) specifically developed for membrane proteins

    • Implement statistical design of experiments (DoE) approaches to simultaneously optimize multiple parameters

  • Inclusion body formation:

    • Reduce expression temperature to 16-20°C to slow protein synthesis and folding

    • Co-express molecular chaperones that aid membrane protein folding

    • Try fusion partners known to enhance solubility (MBP, SUMO, TrxA)

    • Consider refolding protocols specific to membrane proteins using mild detergents

  • Protein toxicity:

    • Use tightly regulated expression systems with minimal leaky expression

    • Implement the Lemo21(DE3) strain that allows for tunable expression

    • Consider cell-free expression systems for highly toxic proteins

    • Develop inducible suicide vector systems for temporary expression

  • Validation approaches:

    • Confirm proper membrane targeting using subcellular fractionation

    • Verify folding state using limited proteolysis

    • Assess function through complementation of RnfE-deficient strains

    • Implement activity assays specific to electron transport function

When working with E. coli O7:K1 strains, the K1 capsule may provide additional challenges including altered membrane properties and potential interference with protein insertion machinery. Develop strain-specific protocols that account for these unique characteristics.

How can researchers design comprehensive controls to validate RnfE functionality in heterologous expression systems?

Robust validation of recombinant RnfE functionality requires systematic control experiments:

  • Genetic complementation controls:

    • Generate clean RnfE deletion mutants in native E. coli backgrounds

    • Complement with both wild-type and recombinant versions of RnfE

    • Assess growth under conditions requiring functional electron transport

    • Quantify restoration of phenotypes using precise growth measurements and metabolic assays

  • Biochemical activity controls:

    • Compare electron transport rates between native and recombinant RnfE using standardized assays

    • Implement negative controls with catalytically inactive mutants (alter conserved residues)

    • Develop in vitro reconstitution systems with purified components to verify intrinsic activity

    • Use isothermal titration calorimetry to verify substrate binding properties

  • Structural integrity controls:

    • Analyze proteolytic digestion patterns between native and recombinant proteins

    • Implement thermal shift assays to compare protein stability profiles

    • Use circular dichroism to verify secondary structure composition

    • Employ native gel electrophoresis to confirm proper complex assembly

  • Specialized controls for E. coli O7:K1 expression:

    • Compare expression and function in isogenic K1-positive and K1-negative backgrounds

    • Assess whether therapeutic targeting of the K1 capsule affects RnfE function

    • Evaluate if capsule production alters membrane composition and RnfE integration

Recent research demonstrates that K1 capsule synthesis enhances E. coli survival in human serum independent of genetic background . When studying RnfE in different contexts, control for potential capsule-dependent effects by expressing in both encapsulated and non-encapsulated backgrounds under identical conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.