Recombinant Escherichia coli O7:K1 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Structure and Function of Fumarate Reductase Subunit C (frdC)

The FRD complex consists of four subunits: FrdA, FrdB, FrdC, and FrdD . FrdC and FrdD are small, hydrophobic proteins that anchor the catalytic subunits FrdA and FrdB to the inner membrane .

Key Functions of FrdC:

  • Membrane Anchor: FrdC is essential for attaching the catalytic subunits, FrdA and FrdB, to the inner surface of the cytoplasmic membrane . This is due to the hydrophobic nature of FrdC .

  • Quinone Binding: FrdC is involved in the binding of quinones, which are crucial for electron transfer within the FRD complex . Menaquinone is presumed to bind at two sites within FrdC and FrdD, designated QA and QB, as part of the FRD redox chain .

Role in Anaerobic Respiration

E. coli uses fumarate as a terminal electron acceptor for anaerobic oxidative phosphorylation, a process enabled by the fumarate reductase enzyme complex encoded by the frdABCD operon . The expression of the frdABCD operon is regulated at the transcriptional level in response to the availability of electron acceptors such as oxygen, fumarate, and nitrate .

Regulation of frdC Expression

The expression of the frdABCD operon, which includes frdC, is significantly influenced by environmental conditions, particularly the availability of electron acceptors .

Factors Affecting Expression:

  • Oxygen: Anaerobic conditions induce the expression of the frdABCD operon, allowing E. coli to use fumarate as an electron acceptor when oxygen is limited .

  • Fumarate: The presence of fumarate, the substrate of the FRD enzyme, further increases the expression of the frdABCD operon .

  • Nitrate: Nitrate, a preferred electron acceptor, represses the expression of the frdABCD operon .

The fnr gene product, Fnr, plays a crucial role in the anaerobic activation of the frd operon expression .

frdC in Uropathogenic E. coli (UPEC)

In UPEC strains, fumarases such as FumC play a significant role during urinary tract infections . Specifically, a strain lacking fumC has a fitness defect during experimental urinary tract infection .

Recombinant Production and Applications

Recombinant E. coli strains are frequently used for the production of various proteins and metabolites . Modifying the N-terminal sequences of recombinant proteins can significantly increase their production yield in E. coli . Techniques such as fluorescence-activated cell sorting (FACS) can be employed to screen for cells with increased expression of the target construct .

Tables and Data

SubunitMolecular Weight (kDa)Function
FrdA~66Catalytic subunit containing FAD
FrdB~27Contains iron-sulfur clusters and is involved in quinone interactions
FrdC~15Membrane anchor, quinone binding
FrdD~13Membrane anchor, quinone binding

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; ECIAI39_4619; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit C (FrdC) anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Fumarate reductase subunit C (frdC) in E. coli metabolism?

Fumarate reductase subunit C (frdC) serves as one of the membrane anchor proteins in the fumarate reductase complex, which catalyzes the reduction of fumarate to succinate during anaerobic respiration in E. coli. Research has demonstrated that both FRD C and FRD D are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues . This enzyme plays a critical role in allowing E. coli to utilize fumarate as a terminal electron acceptor under oxygen-limited conditions.

In experimental studies using recombinant plasmids carrying portions of the E. coli frd operon, researchers have shown that the introduction of all four fumarate reductase subunits is essential for the restoration of anaerobic growth on glycerol and fumarate . The membrane association function provided by frdC is particularly important for electron transport chain functionality under anaerobic conditions.

How does the structure of frdC contribute to fumarate reductase complex assembly?

The frdC gene encodes a hydrophobic membrane protein that works in conjunction with FRD D to anchor the catalytic components (FRD A and FRD B) to the cytoplasmic membrane. Experimental evidence indicates that separating the DNA coding for FRD C and FRD D proteins affects the ability of fumarate reductase to assemble into a functional complex .

The structural arrangement of these components can be visualized as follows:

SubunitLocationPrimary FunctionMolecular Weight (kDa)
FRD ACytoplasmicCatalytic (contains FAD)~66
FRD BCytoplasmicContains iron-sulfur clusters~27
FRD CMembraneMembrane anchor, quinone interaction~15
FRD DMembraneMembrane anchor, quinone interaction~13

Research has demonstrated that while the FRD A and FRD B dimer can function in the benzyl viologen oxidase assay, the proper membrane association and in vivo functionality require the presence of both FRD C and FRD D .

What are the challenges in expressing recombinant frdC in E. coli host systems?

Expressing recombinant frdC presents several challenges that researchers must address through careful experimental design:

  • Membrane protein integration: As a membrane protein, FRD C requires proper cellular machinery for correct folding and membrane insertion. This often necessitates specialized expression vectors and host strains.

  • Subunit coordination: Evidence indicates that all four fumarate reductase subunits must be expressed for proper complex assembly and function . Studies have shown that introducing frdABC and frdD genes on separate plasmid vectors fails to restore anaerobic growth capabilities, suggesting important spatial organization during translation and assembly .

  • Strain-specific modifications: When working with O7:K1 strains, researchers must consider the unique genetic background. Previous research with E. coli O7 has shown that gene expression levels can differ significantly between strains. For instance, the amount of O7 LPS expressed in E. coli K-12 was considerably lower than that produced by the wild-type strain VW187 .

  • Anaerobic expression conditions: Evidence from transcriptome analysis shows that anaerobic conditions significantly alter gene expression in E. coli, with 419 genes differentially expressed during anaerobic growth . This environmental factor must be carefully controlled when studying frdC expression.

How can researchers optimize the cloning strategy for frdC from E. coli O7:K1?

Based on successful cloning approaches documented in the literature, researchers should consider the following methodological approach:

  • Vector selection: Choose vectors capable of stable maintenance under anaerobic conditions with appropriate promoters that function under oxygen limitation.

  • Operon preservation: Maintain the natural organization of the frd operon whenever possible. Research has shown that separating frdC from frdD negatively impacts functionality .

  • Strain selection: Consider using E. coli strains that lack the chromosomal frd operon (such as MI1443) for complementation studies to eliminate background activity .

  • Verification methods: Employ multiple verification approaches:

    • Functional complementation assays measuring anaerobic growth on glycerol and fumarate

    • Benzyl viologen oxidase assays for enzymatic activity

    • Membrane fractionation to confirm proper localization

What assays can accurately measure frdC functionality in recombinant systems?

Researchers have several methodological options for assessing frdC functionality:

  • Anaerobic growth complementation: The most physiologically relevant assay involves measuring the ability of recombinant frdC (in conjunction with other frd subunits) to restore anaerobic growth on glycerol and fumarate in an frd-deficient strain .

  • Membrane association assays: Since FRD C is required for membrane association, membrane fractionation followed by activity assays or immunoblotting can confirm proper localization.

  • Quinone oxidation assays: As FRD C is involved in the oxidation of reduced quinone analogues, specific assays measuring this activity can directly assess frdC function .

  • Protein-protein interaction studies: Techniques such as bacterial two-hybrid systems or co-immunoprecipitation can evaluate the interaction between FRD C and other complex components.

Assay TypeMeasurementAdvantagesLimitations
Anaerobic growthGrowth rate/yieldPhysiologically relevantIndirect measure of activity
Benzyl viologen oxidaseSpectrophotometric activityQuantitative, reproducibleRequires only FRD A/B
Quinone oxidationSpectrophotometric activityDirectly assesses FRD C/DTechnically challenging
Membrane fractionationProtein localizationConfirms proper insertionNot a functional assay

How can researchers distinguish between frdC expression issues and assembly problems?

To differentiate between expression deficiencies and assembly challenges, researchers should implement a systematic approach:

  • Transcriptional analysis: qRT-PCR to confirm frdC mRNA expression levels.

  • Protein detection: Western blotting with FRD C-specific antibodies to verify protein production, potentially using epitope tags if antibodies are unavailable.

  • Subcellular fractionation: To determine if FRD C is properly localized to the membrane fraction .

  • Co-expression analysis: Systematic co-expression of different combinations of frd subunits to identify specific assembly dependencies. Research has demonstrated that all four subunits must be present for full functionality .

  • In vitro reconstitution: Using purified components to test assembly under controlled conditions.

How does the O7:K1 serotype background influence frdC expression and function?

When working with recombinant frdC in an E. coli O7:K1 background, researchers should consider:

  • LPS interactions: The O7 lipopolysaccharide (LPS) antigen creates a unique outer membrane environment that may influence inner membrane protein function. Research on O7 LPS has identified a 17 kilobase pair region essential for O7 LPS expression .

  • Strain-specific expression levels: Evidence suggests expression levels can vary significantly between strains. For example, O7 LPS expression levels were considerably lower in E. coli K-12 than in the wild-type strain VW187 .

  • Genetic uniqueness: O7-specific genes appear to have limited homology with other E. coli O-types, as demonstrated by hybridization studies . This genetic uniqueness may extend to interactions with metabolic systems including fumarate reductase regulation.

  • Anaerobic adaptation: Transcriptome analysis of E. coli under anaerobic conditions revealed significant changes in gene expression, including upregulation of adherence-associated genes and heat shock genes . These global changes may influence frdC expression in O7:K1 strains.

What controls are essential when studying recombinant frdC in different E. coli backgrounds?

Researchers should implement the following controls:

  • Wild-type comparison: Include the original O7:K1 strain to establish baseline fumarate reductase activity and expression levels.

  • Single subunit controls: Test expression of individual frd subunits (A, B, C, D) to confirm the requirement for all components, as demonstrated in previous research .

  • Complementation controls: Use known functional frd constructs in the same strain background to validate that observed phenotypes are specifically due to frdC.

  • Growth condition controls: Compare aerobic and anaerobic conditions, as transcriptome analysis has shown significant differential gene expression between these conditions .

  • Plasmid organization controls: Test configurations with frdC either separated from or coupled with frdD to confirm the importance of coordinate expression, as previous research has shown that separation affects functional assembly .

How do mutations in frdC affect the electron transport chain under anaerobic conditions?

Mutations in frdC can disrupt electron transport in several ways:

  • Membrane association: Mutations affecting hydrophobic domains may prevent proper membrane insertion, eliminating the membrane association of the entire fumarate reductase complex .

  • Quinone interactions: Since FRD C is involved in the oxidation of reduced quinone analogues, mutations in quinone-binding regions would disrupt electron flow from quinones to the catalytic dimer .

  • Complex stability: Certain mutations may allow membrane association but destabilize interactions with other subunits, particularly FRD D, which has been shown to be critical for proper complex assembly .

  • Proton translocation: Some mutations might affect the proton translocation function associated with the membrane components of fumarate reductase, potentially altering energy conservation.

Researchers investigating these effects should employ:

  • Site-directed mutagenesis targeting specific domains

  • In vivo complementation assays to assess functional consequences

  • Membrane potential measurements to evaluate energy coupling

  • Quinone reduction/oxidation assays to assess electron transfer

What is the relationship between frdC expression and transcriptomic changes during anaerobic adaptation?

Transcriptome analysis of E. coli under anaerobic conditions provides insights relevant to fumarate reductase expression:

  • Global regulatory changes: Research has shown that 419 genes are differentially expressed during anaerobic growth, indicating a complex regulatory network that likely influences frd operon expression .

  • Stress response coordination: Heat shock genes (dnaK, dnaJ, groEL, and groES) and stress-responsive sigma factor rpoS are upregulated under anaerobic conditions , suggesting potential interactions with frd gene regulation.

  • Protein synthesis modulation: Transcriptomic data indicates that protein synthesis is retarded during anaerobiosis , which may affect the production and assembly of multi-subunit complexes like fumarate reductase.

  • Virulence-metabolism interactions: Analysis has identified differentially expressed genes located in virulence-related regions (O-islands) under anaerobic conditions , suggesting potential coordination between virulence and metabolic adaptation that may be relevant for O7:K1 strains.

To investigate this relationship, researchers should design experiments that:

  • Compare frdC expression levels under various oxygen concentrations

  • Analyze the effects of deleting global regulators on frdC expression

  • Examine potential co-regulation with other anaerobically induced genes

  • Investigate strain-specific differences in anaerobic transcriptional responses

What techniques show promise for structural analysis of membrane-bound frdC?

Future structural studies of frdC should consider these methodological approaches:

  • Cryo-electron microscopy: Recent advances in cryo-EM have made it possible to resolve membrane protein structures without crystallization, potentially allowing visualization of FRD C in the context of the complete fumarate reductase complex.

  • Hydrogen-deuterium exchange mass spectrometry: This technique can provide insights into protein dynamics and interactions within membrane environments, which would be valuable for understanding how FRD C interacts with other complex components.

  • Native mass spectrometry: Emerging approaches in native MS can maintain non-covalent interactions, allowing researchers to study the intact fumarate reductase complex.

  • Molecular dynamics simulations: Computational approaches can model FRD C interactions with membrane lipids and other subunits, generating testable hypotheses about structure-function relationships.

  • In situ structural techniques: Methods like electron tomography could potentially visualize fumarate reductase complexes in their native membrane environment.

How might synthetic biology approaches enhance our understanding of frdC function?

Synthetic biology offers several promising approaches to frdC research:

  • Domain swapping: Exchanging domains between FRD C proteins from different bacterial species could identify critical functional regions and species-specific adaptations.

  • Minimal function constructs: Designing minimized versions of FRD C that retain essential functions would help define the core structural requirements.

  • Biosensor development: Creating fluorescent reporters linked to fumarate reductase activity could enable high-throughput screening of frdC variants or environmental conditions affecting function.

  • Orthogonal expression systems: Developing controllable expression systems for each fumarate reductase subunit would allow precise manipulation of subunit stoichiometry to study assembly processes.

  • Membrane nanodisc technologies: Reconstituting fumarate reductase complexes in defined lipid environments would enable studies of how membrane composition affects frdC function.

These synthetic biology approaches could significantly advance our understanding of how frdC contributes to fumarate reductase function in E. coli O7:K1 and potentially reveal new insights relevant to bacterial metabolism and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.