Recombinant Escherichia coli O7:K1 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O7:K1 Fumarate Reductase Subunit D (FrdD)

Recombinant Escherichia coli O7:K1 Fumarate reductase subunit D (FrdD) is a component of the fumarate reductase enzyme complex, which is essential for anaerobic respiration in E. coli . Fumarate reductase catalyzes the reduction of fumarate to succinate, utilizing quinol as an electron donor under anaerobic conditions . The enzyme complex comprises four subunits: FrdA, FrdB, FrdC, and FrdD .

  • FrdA: Contains the FAD cofactor and is one of the two catalytic subunits .

  • FrdB: Contains iron-sulfur clusters and is also a catalytic subunit .

  • FrdC and FrdD: Integral membrane proteins that anchor the complex to the membrane and are involved in quinol binding .

Role in Anaerobic Respiration

Fumarate reductase is crucial for anaerobic growth on glycerol, lactate, or formate, where fumarate acts as the terminal electron acceptor . It is also essential for anaerobic hydrogen-dependent growth with fumarate, using menaquinone as the electron donor . The enzyme complex is organized with a cytoplasmic catalytic domain (FrdAB) and a membrane anchor domain (FrdCD), facilitating electron transfer .

Interactions and Pathways

FrdD interacts with other proteins and molecules, as detected by methods such as yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays . Fumarate reductase, including FrdD, participates in pathways that may be useful for research .

Fumarate Reductase in Other Organisms

Fumarate reductase has homologs in various organisms, including Campylobacter jejuni, where it functions as the sole succinate dehydrogenase . Mutants lacking fumarate reductase activity (frdA::cat strain) in C. jejuni exhibit impaired growth under microaerobic conditions . Studies on organisms like Desulfovibrio gigas provide structural insights into electron/proton transfer pathways in quinol:fumarate oxidoreductases (QFR), highlighting the importance of conserved residues and domains in the electron transfer process .

Data Tables

FeatureDescription
Official Full NameFumarate Reductase Subunit D (FrdD)
Source (Host)E. coli
SpeciesHuman
TagHis-Tagged
Protein LengthFull Length (1-125)
FunctionCatalyzes the reduction of fumarate to succinate under anaerobic conditions, essential for anaerobic growth on glycerol, lactate, or formate, and anaerobic hydrogen-dependent growth with fumarate .
Subunit CompositionFrdA, FrdB, FrdC, FrdD
CofactorsFAD, iron-sulfur clusters
Menaquinone Binding SitesLocated in the transmembrane region formed by FrdC and FrdD
InteractionsInteracts with other proteins and molecules involved in electron transfer and anaerobic respiration .
Pathways InvolvedAnaerobic respiration, electron transport chain

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; ECIAI39_4618; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is used during anaerobic growth, while succinate dehydrogenase is used during aerobic growth. The FrdD subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is fumarate reductase subunit D (frdD) and what role does it play in E. coli O7:K1?

Fumarate reductase subunit D (frdD) is one of four subunits (A-D) that comprise the complete fumarate reductase enzyme complex in E. coli. While subunits A and B form the catalytic domain responsible for the reduction of fumarate to succinate during anaerobic metabolism, subunits C and D serve as integral membrane anchors that secure the complex to the cytoplasmic membrane. Specifically, frdD works in conjunction with frdC to anchor the complex and facilitate electron transfer from quinol to the catalytic domain. In E. coli O7:K1, the fumarate reductase complex enables anaerobic respiration when oxygen is unavailable, using fumarate as the terminal electron acceptor .

To study frdD function effectively, researchers should isolate membrane fractions using ultracentrifugation followed by detergent solubilization (typically with n-dodecyl-β-D-maltoside). Activity assays measuring succinate oxidation or fumarate reduction rates can then be performed to assess functional integrity of the complex containing frdD.

How does the frdD gene organization compare between E. coli O7:K1 and standard laboratory strains like K-12?

CharacteristicE. coli O7:K1E. coli K-12Notes
Operon structurefrdABCDfrdABCDConserved organization
Genomic contextMay have unique flanking regionsWell-characterized standardSouthern blot analysis shows O7-specific regions do not hybridize with other E. coli strains
Expression levelsOften higher in pathogenic strainsBaseline expressionPathogenic strains may show different regulation
Sequence homologyStrain-specific variationsReference sequenceO7-specific genes show limited hybridization to other O types

While O7:K1 strains maintain the core functional domains of frdD, regulatory elements and expression patterns may differ from laboratory strains. When cloning frdD from O7:K1, researchers should be aware of these potential differences and design primers accordingly, using genomic Southern blotting to verify specificity .

What are the optimal growth conditions for maximizing native frdD expression in E. coli O7:K1?

Fumarate reductase expression, including the frdD subunit, is primarily regulated by oxygen availability and the presence of alternative electron acceptors. For optimal native expression:

  • Culture cells anaerobically (oxygen < 0.1 ppm) in minimal media

  • Include glucose (0.2-0.5%) as carbon source

  • Add fumarate (20-40 mM) as terminal electron acceptor

  • Maintain pH between 6.8-7.2

  • Harvest cells during late log phase (OD600 ≈ 0.8-1.0)

Temperature effects on expression follow this pattern:

Temperature (°C)Relative frdD ExpressionGrowth RateNotes
25ModerateSlowGood protein folding
30HighModerateOptimal for expression
37HighFastStandard growth temp
42DecreasedStress responseAvoid for expression

It's important to note that expression levels in K-12 strains carrying recombinant O7 genes are considerably lower than in the wild-type strain VW187, suggesting strain-specific regulatory factors that should be considered when designing expression systems .

What strategies can improve the recombinant expression and proper membrane integration of frdD in heterologous systems?

Recombinant expression of membrane proteins like frdD presents significant challenges. Successful strategies include:

  • Vector selection: Use low-copy vectors (pACYC or pBAD series) with tunable promoters to prevent toxic overexpression.

  • Expression hosts: Consider specialized E. coli strains:

    • C41(DE3) or C43(DE3) for toxic membrane proteins

    • Lemo21(DE3) for adjustable expression levels

    • LOBSTR strains for reduced background contamination

  • Fusion tags and partners:

    Tag/PartnerPositionAdvantageDisadvantage
    His8-tagC-terminusMinimal impact on integrationMay interfere with C-term interactions
    MisticN-terminusEnhances membrane targetingLarge fusion partner
    GFPC-terminusMonitors folding/integrationSize may affect function
    SUMON-terminusImproves solubilityRequires post-purification cleavage
  • Expression conditions:

    • Induction at lower temperatures (16-25°C)

    • Extended expression times (16-24 hours)

    • Inclusion of membrane-stabilizing additives (glycerol 5-10%)

    • Co-expression with chaperones (GroEL/ES system)

  • Co-expression strategy: For functional studies, express the entire frdABCD operon rather than frdD alone, as proper assembly and folding may depend on interactions between subunits.

When working with O7:K1-derived constructs, remember that deletion and transposition experiments have identified a region of approximately 17 kilobase pairs essential for proper expression of O7 LPS-related proteins, which may have implications for the regulatory context of frdABCD expression .

How can researchers assess the structural integrity and functional activity of purified recombinant frdD?

Assessing frdD structural integrity requires a multi-faceted approach:

  • Membrane incorporation verification:

    • Membrane fractionation followed by western blotting

    • Protease accessibility assays to confirm proper topology

    • Fluorescence microscopy with GFP-fused constructs

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure

    • Blue-native PAGE to assess complex formation

    • Electron microscopy negative staining to visualize membrane integration

  • Functional assays:

    Assay TypeMeasurementAdvantagesLimitations
    Quinol oxidationRate of quinol oxidation coupled to fumarate reductionDirect assessment of electron transferRequires intact complex
    Membrane potentialChanges in membrane potential using fluorescent dyesNon-destructiveIndirect measure
    ReconstitutionActivity after incorporation into liposomesControlled environmentTechnical complexity
    Site-directed spin labelingEPR spectroscopy to measure conformational changesHigh resolution structural dataRequires specialized equipment
  • Quinone binding assays:

    • Isothermal titration calorimetry (ITC)

    • Tryptophan fluorescence quenching

    • Photoaffinity labeling with quinone analogs

For meaningful results, compare the data with native FRD complex isolated from anaerobically grown E. coli. Remember that assessing frdD in isolation is challenging; most functional assays require the intact FRD complex, as the membrane anchor subunits work in concert with the catalytic domains .

What are the key experimental considerations when investigating cis vs. trans flavinylation mechanisms in FRD complexes containing frdD?

Based on studies with other fumarate reductases, flavinylation mechanisms are critical to FRD function but present experimental challenges:

  • Experimental design approaches:

    • Domain swap experiments between different FRD isoforms

    • Site-directed mutagenesis of putative flavinylation target motifs

    • In vitro flavinylation assays with purified components

    • Comparative analysis between isolated domains and full-length proteins

  • Critical experimental factors:

    FactorConsiderationRecommendation
    Flavin detectionSensitivity limitsUse fluorescence detection (ex: 450nm, em: 520nm)
    Protein expressionStoichiometry controlUse dual promoter systems or polycistronic constructs
    Subcellular localizationNative environmentTarget proteins to proper compartments (membrane vs. cytosol)
    Kinetic analysisReaction mechanismsApply appropriate models (Michael-Menten vs. bi-substrate)
  • Advanced analytical approaches:

    • Mass spectrometry to identify flavinylated residues

    • Real-time monitoring of flavinylation using fluorescence polarization

    • Isothermal titration calorimetry to determine binding constants

As demonstrated in research with kinetoplastid FRDs, cis-flavinylation of target motifs by adjacent domains can be at least 5-fold more efficient than trans-flavinylation. This higher efficiency is consistent with single-substrate Michael-Menten kinetics compared to a random bi-substrate mechanism for trans-flavinylation . When designing experiments with E. coli frdD, consider these mechanistic differences, especially when the membrane environment may impact protein-protein interactions.

What are common challenges in purifying functional recombinant frdD and how can they be addressed?

Purification of membrane proteins like frdD presents several challenges:

  • Solubilization issues:

    DetergentConcentrationBest forLimitations
    DDM1-2%Maintaining complex integrityDifficult to remove
    LMNG0.01-0.05%High stabilityExpensive
    Digitonin0.5-1%Native-like environmentBatch variability
    SMA copolymer2.5%Detergent-free extractionpH limitations

    Solution: Screen multiple detergents in parallel; consider using fluorescence-based thermal stability assays to identify optimal conditions.

  • Low yield challenges:

    • Scale up culture volume (10-20L)

    • Optimize induction conditions (timing, temperature, inducer concentration)

    • Consider using high-density fermentation

    • Develop dual selection expression systems

  • Aggregation during purification:

    • Include stabilizing additives: glycerol (10-20%), specific lipids (0.1-0.5 mg/mL)

    • Maintain samples at 4°C throughout

    • Avoid freeze-thaw cycles

    • Use sucrose density gradients for separating aggregates

  • Loss of quaternary structure:

    • Co-express all four subunits (frdABCD)

    • Add lipids during purification to stabilize interactions

    • Consider mild crosslinking to maintain complex integrity

    • Use blue native PAGE to monitor complex assembly

  • Activity loss during purification:

    • Minimize exposure to air (use argon-sparged buffers)

    • Include reducing agents (2-5 mM DTT or β-mercaptoethanol)

    • Add substrates or substrate analogs to stabilize active conformation

    • Perform activity assays at each purification step to track recovery

When working with recombinant O7:K1 proteins, remember that expression levels in K-12 strains are considerably lower than in wild-type strains , which may necessitate additional optimization steps or the use of specialized expression hosts.

How should researchers design site-directed mutagenesis experiments to investigate the role of specific residues in frdD function?

Effective site-directed mutagenesis requires careful planning:

  • Target selection strategy:

    • Conserved residues across species (sequence alignment)

    • Predicted membrane-spanning regions

    • Residues at subunit interfaces (particularly frdC-frdD)

    • Putative quinone binding sites

    • Potential proton transfer pathway residues

  • Mutation design principles:

    Mutation TypePurposeExample Substitutions
    ConservativeTest chemical propertyLeu→Ile, Asp→Glu
    Non-conservativeDisrupt functionCharged→hydrophobic
    Alanine scanningMinimal side chainAny→Ala
    Cysteine scanningCrosslinking studiesAny→Cys
    Charge reversalTest electrostatic interactionsLys→Asp, Asp→Lys
  • Experimental validation hierarchy:

    • Expression verification (western blot)

    • Membrane integration (fractionation)

    • Complex assembly (blue native PAGE)

    • Enzyme activity (quinol:fumarate oxidoreductase assay)

    • Detailed kinetic analysis (KM, Vmax, inhibitor sensitivity)

  • Advanced functional characterization:

    • Differential scanning calorimetry to assess thermal stability

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Electron paramagnetic resonance (EPR) with spin-labeled proteins

    • Distance measurements using double electron-electron resonance (DEER)

For specific studies of flavinylation mechanisms relevant to fumarate reductases, target the flavinylation motif with a consensus sequence of Dxx(s/t)(s/g)AS. Replacing serine residues in this motif has been shown to abolish both flavinylation and enzymatic activity in related systems .

What approaches can resolve contradictory experimental results when studying frdD expression and function?

Resolving contradictory results requires systematic troubleshooting:

  • Standardization of experimental conditions:

    • Use consistent growth media formulations

    • Standardize oxygen levels (use anaerobic chambers with oxygen sensors)

    • Define precise harvesting timepoints (OD600)

    • Establish uniform protein quantification methods

  • Strain and construct verification:

    • Sequence verification of all constructs

    • Phenotypic confirmation of host strains

    • Testing for spontaneous suppressor mutations

    • PCR verification of genomic context

  • Systematic variation analysis:

    Variable FactorTest RangeControl Method
    Expression temperature16-42°CTemperature-controlled incubators
    Induction level0.01-1.0 mM IPTGQuantitative dose-response
    Growth phaseEarly, mid, late logTime-course sampling
    Membrane preparationDifferent extraction methodsSide-by-side comparison
  • Inter-laboratory validation:

    • Exchange of materials (plasmids, strains)

    • Standardized protocols

    • Blind testing of samples

    • Round-robin testing of key results

  • Advanced analytical resolution:

    • Heterologous expression in multiple hosts

    • In vitro transcription/translation systems

    • Reconstitution experiments with purified components

    • Single-molecule techniques to detect subpopulations

When working with recombinant O7:K1 genes in E. coli K-12 strains, remember that expression levels are typically lower than in the original strain. This observation from the literature may explain certain discrepancies, especially in functional studies where threshold levels of expression may be necessary for detecting activity.

What statistical approaches are most appropriate for analyzing functional data from frdD mutational studies?

Proper statistical analysis is critical for meaningful interpretation:

  • Experimental design considerations:

    • Minimum of 3-5 biological replicates

    • Include technical replicates (3 per biological replicate)

    • Incorporate appropriate positive and negative controls

    • Consider power analysis to determine sample size

  • Statistical tests by experiment type:

    Experiment TypeAppropriate TestsVisualization
    Activity comparisonsANOVA with post-hoc testsBox plots, bar graphs with error bars
    Kinetic parametersNonlinear regression, AIC for model selectionMichaelis-Menten plots
    ThermostabilityBoltzmann sigmoidal fittingThermal melt curves
    Expression levelst-tests or ANOVA, normality testsNormalized bar graphs
  • Advanced statistical approaches:

    • Multivariate analysis for complex datasets

    • Principal component analysis for identifying patterns

    • Hierarchical clustering for grouping similar mutants

    • Bootstrapping for robust confidence intervals

  • Avoiding common pitfalls:

    • Always test for normality before applying parametric tests

    • Use appropriate corrections for multiple comparisons

    • Report effect sizes alongside p-values

    • Consider Bayesian approaches for small sample sizes

For complex datasets comparing multiple mutations across different conditions, hierarchical statistical approaches combined with heat map visualization can effectively identify patterns that might not be apparent from individual comparisons.

How can structural biology approaches enhance our understanding of frdD in the context of the complete fumarate reductase complex?

Structural biology offers powerful insights into frdD function:

When designing structural studies, consider that the ApbE-like domains found in some fumarate reductases are structurally independent , which has implications for protein engineering approaches and interpretation of structural data.

What emerging technologies hold promise for advancing research on recombinant frdD and related membrane proteins?

Several cutting-edge technologies offer new opportunities:

  • Advanced expression systems:

    • Cell-free protein synthesis with nanodiscs for direct membrane protein production

    • Synthetic minimal cells for controlled expression environment

    • Xenobiology approaches with expanded genetic codes for novel amino acid incorporation

    • Genome-edited chassis strains optimized for membrane protein expression

  • Innovative characterization techniques:

    TechnologyApplicationAdvantage
    Single-particle cryo-EMHigh-resolution structuresWorks with smaller samples, captures multiple states
    Microfluidic diffusional sizingBinding studiesMinimal sample consumption, native conditions
    Native mass spectrometryComplex stoichiometryPreserves non-covalent interactions
    Serial femtosecond crystallographyRoom-temperature structuresCaptures physiological conformations
    smFRETConformational dynamicsSingle-molecule resolution of states
  • Computational advances:

    • AlphaFold2 and RoseTTAFold for structure prediction

    • Molecular dynamics with polarizable force fields

    • Machine learning for predicting optimal expression conditions

    • Quantum mechanical/molecular mechanical (QM/MM) calculations for reaction mechanisms

  • Functional genomics approaches:

    • CRISPR interference for controlled gene repression

    • Deep mutational scanning for comprehensive variant analysis

    • Ribosome profiling to monitor translation efficiency

    • Transposon sequencing to identify genetic interactions

For future studies of flavinylation mechanisms, consider leveraging the finding that cis-flavinylation efficiency is at least 5-fold higher than trans-flavinylation . This mechanistic insight could guide the design of optimized expression systems for recombinant fumarate reductases with enhanced activity.

How can findings from recombinant frdD studies inform broader understanding of bacterial energy metabolism?

Research on frdD contributes to fundamental understanding in multiple areas:

  • Evolutionary insights:

    • Comparative analysis of frd operons across species reveals adaptation patterns

    • The unique nature of O7 LPS genes demonstrated by lack of hybridization to other E. coli O types suggests strain-specific adaptations that may extend to energy metabolism

    • Convergent vs. divergent evolution of membrane protein complexes

  • Bioenergetic principles:

    • Proton motive force generation mechanisms

    • Electron transfer through membrane complexes

    • Redox balance maintenance during anaerobic growth

    • Metabolic flexibility in changing environments

  • Structure-function relationships:

    • Membrane protein assembly and stability determinants

    • Subunit interaction networks in multi-component complexes

    • Conformational changes during catalytic cycles

    • Lipid-protein interactions in membrane protein function

Understanding the flavinylation mechanisms of fumarate reductases, particularly the efficiency differences between cis- and trans-flavinylation , provides insights into post-translational modifications that may be applicable to other enzyme systems requiring flavin cofactors.

What considerations should guide experimental design when applying FRED (Framework for Reliable Experimental Design) to frdD research?

Implementing FRED principles enhances research rigor:

  • Planning phase:

    • Define clear hypotheses and specific objectives

    • Conduct comprehensive literature review including contradictory findings

    • Establish appropriate controls and reference standards

    • Calculate sample sizes needed for statistical power

  • Implementation phase:

    FRED ComponentApplication to frdD ResearchBenefit
    Method validationConfirm antibody specificity, assay linearityEnsures reliable measurements
    Procedural consistencyStandardized protocols for membrane preparationReduces variability
    RandomizationRandom sample order for activity measurementsMinimizes systematic bias
    BlindingBlinded analysis of mutant phenotypesPrevents confirmation bias
  • Analysis phase:

    • Apply appropriate statistical tests based on data distribution

    • Use multiple analytical approaches to confirm findings

    • Test for reproducibility across different experimental conditions

    • Consider potential confounding variables

  • Reporting phase:

    • Full disclosure of all experimental conditions

    • Complete description of all controls used

    • Raw data availability for independent verification

    • Transparent discussion of limitations

When conducting research on recombinant proteins from E. coli O7:K1, the observation that expression levels in K-12 strains are considerably lower than in wild-type strains should be incorporated into experimental design, particularly in establishing appropriate sensitivity thresholds and controls.

How might research on recombinant frdD contribute to broader applications in synthetic biology and biotechnology?

Insights from frdD research extend beyond basic science:

  • Synthetic biology applications:

    • Designer electron transport chains with optimized efficiency

    • Engineered anaerobic metabolism for bioproduction

    • Minimal respiratory systems for synthetic cells

    • Modular membrane protein assembly platforms

  • Biotechnological potential:

    Application AreaPotential ContributionTechnical Approach
    BiocatalysisImmobilized FRD for chiral compound synthesisEnzyme engineering for stability
    BiosensorsFRD-based detection of respiratory inhibitorsElectrochemical coupling
    Biofuel cellsElectron transfer to electrodesMembrane protein immobilization
    Metabolic engineeringEnhanced succinate productionPathway optimization
  • Transferable methodologies:

    • Membrane protein expression optimization strategies

    • Efficient flavinylation approaches for enzyme engineering

    • Structure-guided design of membrane-associated complexes

    • High-throughput assays for membrane protein function

The finding that cis-flavinylation is significantly more efficient than trans-flavinylation may inform design strategies for engineered flavoproteins in biotechnological applications, potentially improving catalytic efficiency and stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.