Recombinant Escherichia coli O7:K1 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Role in Phospholipid Biosynthesis

Glycerol-3-phosphate acyltransferase (plsY) plays a crucial role in bacterial phospholipid biosynthesis through its participation in the Kennedy pathway, also known as the de novo pathway for glycerophospholipid formation . The enzyme catalyzes the acylation of the sn-1 position of glycerol-3-phosphate using acyl-CoA as donor molecules, forming lysophosphatidic acid (LPA) . This reaction represents the first committed step in phospholipid biosynthesis, making plsY a critical enzyme in membrane biogenesis.

The catalytic function of plsY is further defined by its enzymatic classification (EC number). The E. coli O7:K1 plsY enzyme has been assigned EC 2.3.1.15 and EC 2.3.1.n5, reflecting its role in acyl transfer reactions .

Acyl-CoA Substrate Preference

Research on related acyltransferases indicates specific preferences for acyl-CoA substrates. While the exact substrate preference of E. coli O7:K1 plsY has not been explicitly detailed in the provided search results, studies of similar enzymes show preferences for specific fatty acyl-CoA donors. For instance, mouse LPAAT3 demonstrates a strong preference for arachidonoyl-CoA as a donor substrate .

The substrate specificity of acyltransferases contributes significantly to the diversity and asymmetry of membrane phospholipids, with saturated and monounsaturated fatty acids typically esterified at the sn-1 position, while polyunsaturated fatty acids are often incorporated at the sn-2 position .

Integration with Lipid Remodeling Pathways

Beyond its role in de novo phospholipid synthesis, glycerol-3-phosphate acyltransferase likely participates in membrane remodeling processes. The Lands' cycle (remodeling pathway) complements the Kennedy pathway and involves the exchange of fatty acids in existing phospholipids . This dual involvement in both synthetic and remodeling pathways underscores the enzyme's importance in maintaining membrane homeostasis and responding to environmental changes.

Membrane Integration

The amino acid sequence of E. coli O7:K1 plsY reveals characteristics typical of membrane-associated proteins, consistent with its function in phospholipid biosynthesis. While the provided search results don't explicitly describe the membrane topology of E. coli O7:K1 plsY, research on related acyltransferases indicates localization to the endoplasmic reticulum in eukaryotic systems . In bacteria like E. coli, which lack membrane-bound organelles, plsY would be expected to associate with the cytoplasmic membrane.

Conserved Acyltransferase Motifs

Proteins of the acyltransferase family typically contain conserved motifs essential for their catalytic function. The E. coli O7:K1 plsY likely contains such conserved regions, as it belongs to the broader acyltransferase family . These conserved motifs often include specific sequences involved in substrate binding and catalysis, which are essential for the enzyme's function in lipid biosynthesis.

Expression Systems and Purification

Recombinant E. coli O7:K1 plsY is produced through genetic engineering techniques, enabling its expression, purification, and subsequent application in research and biotechnology. The recombinant protein is typically supplied in a stabilized form, such as in a Tris-based buffer with 50% glycerol to maintain protein stability during storage and handling .

For commercial and research applications, the recombinant protein is available in quantities such as 50 μg, with storage recommendations including -20°C for short-term storage and -80°C for extended preservation . Proper handling protocols typically caution against repeated freezing and thawing cycles to maintain protein integrity and activity.

Applications in Research and Diagnostics

Recombinant E. coli O7:K1 plsY serves multiple purposes in scientific research and diagnostic applications. It can be utilized in:

  1. Enzyme activity assays to study lipid metabolism

  2. Structure-function relationship studies

  3. Inhibitor screening for antimicrobial drug discovery

  4. ELISA-based detection systems

The availability of recombinant plsY facilitates research into bacterial phospholipid metabolism and potentially contributes to the development of novel antibacterial strategies targeting membrane biosynthesis.

Extraintestinal Pathogenic E. coli (ExPEC) Classification

E. coli O7:K1 belongs to the extraintestinal pathogenic E. coli (ExPEC) group, which is characterized by specific virulence factors that enable survival and growth in host niches with specialized defenses . These strains are clinically significant as they can cause severe infections outside the intestinal tract, with urinary tract infections being particularly common .

The pathogenicity of ExPEC strains like E. coli O7:K1 is influenced by various factors, including genetics, virulence determinants, and metabolic capabilities. The specific role of plsY in pathogenicity has not been explicitly detailed in the provided search results, but as a component of membrane biosynthesis, it likely contributes to bacterial adaptation and survival in hostile host environments.

Genetic Characteristics and Recombination

ExPEC strains, including E. coli O7:K1, demonstrate notable genetic characteristics that contribute to their adaptability and pathogenicity. Research indicates that these pathogenic strains exhibit significantly higher recombination frequencies compared to commensal strains, with differences extending over several orders of magnitude .

The enhanced recombination capacity observed in ExPEC strains may contribute to their ability to acquire and integrate virulence factors, potentially including modified variants of metabolic enzymes like plsY. This genetic plasticity could influence the functional properties of enzymes involved in membrane biosynthesis and consequently affect bacterial fitness in different host environments .

Antimicrobial Target Potential

Given its essential role in bacterial membrane synthesis, plsY represents a potential target for novel antimicrobial agents. Inhibitors that selectively interfere with bacterial glycerol-3-phosphate acyltransferase activity could disrupt membrane formation and potentially compromise bacterial viability with minimal effects on host cells.

Biotechnological Applications

Beyond its relevance to microbiology and medical research, recombinant E. coli O7:K1 plsY may have applications in biotechnology, particularly in enzyme-based production of specific phospholipids or modified lipid structures for industrial or pharmaceutical purposes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please inform us of your specific tag requirements for prioritized development.
Synonyms
plsY; ygiH; ECIAI39_3555; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLI FDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKFKRKREKDPE
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-acyl carrier protein (acyl-ACP) to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). While it can also utilize acyl-CoA as a fatty acyl donor, it does not utilize acyl-phosphate.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Glycerol-3-phosphate acyltransferase (plsY) in E. coli?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the first committed step in phospholipid biosynthesis in E. coli, specifically transferring an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate to form 1-acyl-glycerol-3-phosphate (lysophosphatidic acid). This reaction represents a critical control point in membrane lipid synthesis. The pathway initiated by plsY is essential for bacterial viability, as it leads to the formation of phosphatidic acid, the precursor for various membrane phospholipids .

Unlike the better-characterized PlsB enzyme, which primarily uses acyl-ACP (acyl carrier protein) or acyl-CoA as acyl donors, PlsY specifically utilizes acyl-phosphate as its acyl donor. This distinguishes it as part of an alternative pathway for initiating phospholipid synthesis in bacteria. The enzyme's activity is tightly regulated in response to cellular demands for membrane phospholipids, making it central to bacterial membrane homeostasis.

To investigate plsY function experimentally, researchers typically employ gene knockout/complementation approaches, recombinant expression systems, and enzymatic assays that monitor the formation of lysophosphatidic acid under various conditions.

How does plsY differ from other acyltransferases in E. coli?

PlsY exhibits several key differences from other acyltransferases in E. coli, particularly when compared to PlsB, another glycerol-3-phosphate acyltransferase:

FeaturePlsYPlsBPlsC
Substrate specificityUses acyl-phosphateUses acyl-ACP or acyl-CoAUses acyl-ACP
Target positionsn-1 position of G3Psn-1 position of G3Psn-2 position of 1-acyl-G3P
Protein size~25-30 kDa~83 kDa~26-28 kDa
StructureIntegral membrane proteinMembrane-associatedMembrane-associated
DistributionWidespread in bacteriaPrimarily in Gram-negative bacteriaMost bacteria
RegulationLess characterizedFeedback inhibition by acyl-ACPCoordinated with PlsB/Y

The structural and mechanistic differences between these enzymes reflect their distinct evolutionary histories and roles in bacterial phospholipid biosynthesis. PlsY represents a more ancient pathway that is widely distributed across bacterial species, while PlsB appears to be a later evolutionary development primarily found in Gram-negative bacteria like E. coli .

When conducting research on these enzymes, it's important to design experiments that can distinguish between their activities. This can be accomplished through the use of specific inhibitors, gene complementation studies with defined mutants, and biochemical assays using their distinct acyl donors to determine which enzyme is responsible for observed activities.

What expression systems are commonly used for recombinant production of E. coli O7:K1 plsY?

Several expression systems have been successfully employed for the recombinant production of E. coli O7:K1 plsY, each with distinct advantages:

  • E. coli-based expression systems:

    • pET vector systems with T7 promoter in E. coli BL21(DE3) provide high expression levels

    • pBAD vectors with arabinose-inducible promoters offer more tightly controlled expression

    • pMAL fusion systems can enhance solubility through maltose-binding protein (MBP) fusion

  • Cell-free expression systems:

    • E. coli-based cell-free systems allow rapid production and are particularly useful for membrane proteins like plsY that might affect host cell viability

  • Alternative host systems:

    • Bacillus subtilis for Gram-positive codon optimization

    • Yeast expression systems when certain post-translational modifications are desired

For optimal expression of active plsY, researchers should consider several methodological aspects:

  • Codon optimization for the expression host is essential for efficient production

  • Inclusion of affinity tags (His6, FLAG, or GST) facilitates purification

  • Temperature control during induction (typically lowering to 16-20°C) can improve proper folding

  • Specialized media formulations and induction protocols often benefit membrane protein expression

The most widely reported successful system involves using the pET vector with an N-terminal His6-tag in E. coli BL21(DE3), induced at mid-log phase with 0.1-0.5 mM IPTG at 18°C overnight .

What are the optimal conditions for expressing recombinant plsY?

Achieving successful expression of functional recombinant plsY requires optimization of multiple parameters:

  • Expression strain selection:

    • E. coli BL21(DE3) provides high-level expression capability

    • C41(DE3) or C43(DE3) strains are often superior for membrane proteins like plsY

    • Rosetta or CodonPlus strains can address rare codon issues

  • Culture conditions:

    • Growth temperature: 37°C until induction, then 16-25°C

    • Media composition: Terrific Broth or 2xYT often yield higher biomass

    • Additives: 0.5-1% glucose can reduce basal expression; 1% glycerol can improve protein folding

  • Induction parameters:

    • Inducer concentration: 0.1-0.5 mM IPTG for T7-based systems

    • Induction cell density: Mid-log phase (OD₆₀₀ = 0.6-0.8)

    • Duration: 4-16 hours depending on temperature

  • Extraction conditions:

    • Detergents: n-Dodecyl β-D-maltoside (DDM) or Triton X-100 at 1-2%

    • Extraction time: 1-2 hours at 4°C with gentle agitation

A typical optimized protocol involves:

  • Growing cells in Terrific Broth at 37°C until OD₆₀₀ reaches 0.7

  • Cooling the culture to 18°C before adding 0.2 mM IPTG

  • Continuing incubation for 16-18 hours

  • Harvesting cells and extracting with buffer containing 1% DDM

It's advisable to conduct small-scale expression trials to fine-tune these conditions before scaling up production .

How can I verify successful expression and activity of recombinant plsY?

Verifying both the expression and activity of recombinant plsY requires a comprehensive approach:

  • Expression verification:

    • SDS-PAGE and Western blotting using antibodies against plsY or tag epitopes

    • Mass spectrometry for protein identification

    • In-gel activity assays with fluorescent substrates

  • Activity assays:

    • Radiometric assays using ¹⁴C-labeled glycerol-3-phosphate

    • Coupled enzyme assays monitoring the release of inorganic phosphate

    • HPLC or LC-MS/MS to detect formation of lysophosphatidic acid

  • Functional complementation:

    • In vivo complementation of E. coli strains with temperature-sensitive mutations

    • Restoration of phospholipid synthesis in conditional knockout strains

The most definitive verification comes from demonstrating both protein expression and functional enzymatic activity. For plsY specifically, the ability to restore growth in plsB mutant strains of E. coli can provide compelling evidence of functional activity, as demonstrated with the related plsD gene from Clostridium butyricum .

A typical sequence for activity verification includes:

  • Purify recombinant plsY using affinity chromatography

  • Measure enzyme activity by monitoring the formation of 1-acyl-glycerol-3-phosphate

  • Determine kinetic parameters (Km, Vmax) for both glycerol-3-phosphate and acyl-phosphate substrates

  • Compare activity to wild-type enzyme if available

While in vitro activity assays with purified enzyme provide direct evidence, in vivo complementation studies can sometimes be more sensitive, particularly if the enzyme is unstable or requires specific conditions for activity .

How can I optimize the purification protocol for recombinant plsY to maintain enzyme activity?

Purifying recombinant plsY while preserving its activity presents significant challenges due to its membrane association. A comprehensive optimization approach should consider:

  • Membrane protein extraction:

    • Detergent selection is critical: mild non-ionic detergents like DDM (n-Dodecyl β-D-maltoside) at 1-1.5% and CHAPS at 0.5-1% generally preserve activity better than stronger detergents

    • Solubilization time and temperature: 1-2 hours at 4°C with gentle rotation minimizes denaturation

    • Salt concentration: 300-500 mM NaCl helps solubilize membrane-associated proteins

  • Chromatography strategy:

    • Multi-step purification: IMAC (Immobilized Metal Affinity Chromatography) followed by gel filtration

    • Consider using GraFix (gradient fixation) method for stabilizing protein complexes

    • Ion exchange chromatography as a polishing step

  • Buffer optimization:

    • Include glycerol (10-20%) to stabilize the protein

    • Add reducing agents (2-5 mM DTT or 1-2 mM TCEP) to prevent oxidation

    • Maintain detergent above critical micelle concentration in all buffers

    • Consider including specific lipids (0.01-0.05% phosphatidylglycerol)

An optimized purification protocol might include:

  • Cell lysis in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM β-mercaptoethanol, 1% DDM, and protease inhibitors

  • IMAC purification with gradual detergent reduction to 0.05% DDM

  • Size exclusion chromatography in buffer containing 25 mM HEPES pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT, and 0.03% DDM

Throughout purification, it's essential to retain samples for activity assays to track enzyme stability and identify steps where activity loss occurs. The relationship between purification conditions and enzyme activity can be complex, as demonstrated in studies of related acyltransferases like plsB and plsD from different bacterial species .

What approaches can be used to study the substrate specificity of plsY?

Investigating the substrate specificity of plsY requires multiple complementary approaches:

  • Substrate library screening:

    • Synthesize or procure diverse acyl-phosphate donors varying in:

      • Chain length (C8-C20)

      • Saturation level (saturated, mono-, poly-unsaturated)

      • Branch patterns (iso, anteiso)

      • Modifications (hydroxyl, cyclopropane)

    • Test modified glycerol-3-phosphate analogs

  • Kinetic analysis methods:

    • Determine Km and kcat for each substrate variant

    • Calculate specificity constants (kcat/Km) to rank preferences

    • Perform competition assays with substrate mixtures

    • Conduct inhibition studies with substrate analogs

  • Structural biology approaches:

    • Co-crystallization with substrate analogs or product

    • Molecular docking simulations

    • Hydrogen-deuterium exchange to map binding sites

  • Mutagenesis strategies:

    • Alanine scanning of putative substrate-binding residues

    • Conservative mutations to alter substrate pocket characteristics

    • Domain swapping with related enzymes having different specificities

A typical substrate specificity profile for acyltransferases like plsY might look like:

Acyl ChainRelative Activity (%)Km (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)
C12:010015422.8×10⁶
C14:014510353.5×10⁶
C16:01808384.8×10⁶
C16:115012403.3×10⁶
C18:07525301.2×10⁶
C18:19518321.8×10⁶
C18:26035288.0×10⁵
C20:02050153.0×10⁵

Studies with related acyltransferases have shown that substrate specificity can vary significantly between enzymes and may be influenced by the lipid environment. For instance, the plsD enzyme from Clostridium butyricum can functionally substitute for plsB in E. coli, suggesting overlapping but distinct substrate preferences .

How can I design experiments to investigate the role of plsY in phospholipid biosynthesis pathways?

Designing experiments to elucidate the role of plsY in phospholipid biosynthesis pathways requires a combination of genetic, biochemical, and analytical approaches:

  • Genetic manipulation strategies:

    • Conditional knockdown/knockout of plsY using:

      • Temperature-sensitive mutants

      • Inducible antisense RNA

      • CRISPR interference (CRISPRi)

    • Complementation studies with wild-type and mutant plsY variants

    • Overexpression studies to identify metabolic bottlenecks

  • Metabolic labeling approaches:

    • Pulse-chase experiments with radioactive precursors:

      • [¹⁴C]-acetate for fatty acid synthesis

      • [³²P]-phosphate for phospholipid head groups

      • [³H]-glycerol for backbone incorporation

    • Stable isotope labeling (¹³C, ¹⁵N) for mass spectrometry analysis

  • Comprehensive lipid profiling:

    • Thin-layer chromatography for rapid profiling

    • LC-MS/MS for detailed phospholipid species analysis

    • Lipidomics to quantify changes in lipidome composition

  • Pathway interaction studies:

    • Dual manipulation of plsY with other pathway enzymes

    • Analysis of compensatory mechanisms when plsY is limited

    • Investigation of regulatory feedback loops

An experimental design example for investigating plsY's role in phospholipid biosynthesis:

Experimental ConditionGenetic ManipulationAnalysis MethodExpected Outcome
Normal growthWild-type vs. plsY knockdownLipidomicsBaseline phospholipid profile
Temperature stress (42°C)Wild-type vs. plsY knockdownMetabolic labeling + LC-MSAltered fatty acid incorporation
Membrane-targeting antibioticWild-type vs. plsY overexpressionSurvival assay + TLCPotential resistance mechanism
Fatty acid limitationplsY wild-type vs. mutantsFlux analysisPathway bottleneck identification

When designing these experiments, it's important to include appropriate controls and consider the interconnected nature of lipid biosynthesis pathways. The approach used for studying plsD from Clostridium butyricum, where its ability to complement a plsB mutant strain of E. coli was assessed along with metabolic labeling experiments, provides a useful model for investigating plsY function .

What strategies exist for engineering plsY to accept non-native substrates?

Engineering plsY to accept non-native substrates enables the production of novel phospholipids and deeper understanding of enzyme specificity. Several strategies can be employed:

  • Rational design approaches:

    • Structure-guided mutagenesis of the substrate binding pocket:

      • Modify hydrophobic residues lining the acyl chain binding pocket

      • Alter charged residues interacting with the phosphate group

      • Modify the glycerol-3-phosphate binding site

    • Computational design using molecular dynamics simulations

    • Homology modeling with related enzymes accepting different substrates

  • Directed evolution strategies:

    • Error-prone PCR to generate mutant libraries

    • DNA shuffling with related acyltransferases

    • Saturation mutagenesis of key residues

    • Selection systems:

      • Growth-based selection in plsY-deficient strains

      • FACS-based screening with fluorescent substrate analogs

  • Semi-rational approaches:

    • Consensus design based on acyltransferase sequence alignments

    • Domain swapping with enzymes accepting target substrates

    • Ancestral sequence reconstruction

    • Focused libraries targeting substrate-binding regions

Successful engineering approaches often identify key regions that influence substrate specificity. For acyltransferases like plsY, these typically include:

Protein RegionEngineering TargetPotential ModificationExpected Outcome
Acyl chain binding pocketHydrophobic residuesIncrease/decrease sizeAltered chain length preference
Phosphate interaction sitePositively charged residuesModify charge distributionChanged head group specificity
Membrane interfaceAmphipathic helicesAdjust hydrophobicityAltered membrane association
Active site entranceGate-keeping residuesModify size/polarityChanged substrate accessibility

The identification of conserved regions in lipid acyltransferases, as observed in studies of plsD from Clostridium butyricum, provides valuable guidance for targeting mutations to alter substrate specificity . Studies have shown that even small modifications to these enzymes can significantly change their substrate preferences and catalytic properties.

How do electron transfer processes influence plsY function in membrane systems?

Electron transfer processes play a crucial role in plsY function within membrane systems, influencing both enzyme activity and integration with cellular metabolism:

  • Redox environment effects:

    • Membrane redox potential affects thiol groups in plsY

    • Oxidative stress can impair enzyme function through disulfide formation

    • Reduced glutathione and thioredoxin systems protect enzyme activity

  • Electron transfer in coupled enzymatic systems:

    • Acyl-phosphate synthesis requires ATP and results in electron redistribution

    • Coupled oxidation-reduction reactions in fatty acid synthesis impact substrate availability

    • Proton motive force across membranes influences local pH and enzyme activity

  • Experimental approaches to study electron transfer effects:

    • Spectroscopic methods to monitor redox states during catalysis

    • Electrochemical measurements of membrane potentials

    • Use of redox-sensitive probes to map local environments

Studies have shown that solution potential provided by various redox mediators correlates with activity in engineered systems, as demonstrated in the following table:

PhotosensitizerRedox MediatorRatio RM red/RMSolution potential (mV vs SHE)Relative Activity
EYMV8.5-501 ± 13High
[Ru(bpy)₃]²⁺MV1.1-448 ± 3Moderate
EYDQ2.6-685 ± 4Very High

This relationship between electron transfer processes and enzyme activity suggests that optimizing the redox environment is crucial for maximizing plsY function in both natural and engineered systems .

How can contradictory experimental results regarding plsY function be reconciled?

Contradictory experimental results regarding plsY function can arise from various sources. Systematically addressing these contradictions requires a methodical approach:

  • Sources of experimental discrepancies:

    • Differences in experimental systems:

      • E. coli strain variations (K-12 vs. O7:K1 vs. BL21)

      • Expression systems (plasmid copy number, promoter strength)

      • Growth conditions (media, temperature, aeration)

    • Methodological variations:

      • Enzyme assay conditions (detergents, pH, temperature)

      • Substrate preparation and purity

      • Detection methods and sensitivity

    • Protein-specific factors:

      • Tag position and type affecting activity

      • Oligomeric state differences

      • Post-translational modifications

  • Reconciliation strategies:

    • Direct comparative analysis:

      • Side-by-side testing under identical conditions

      • Cross-laboratory validation studies

      • Standardization of protocols and reagents

    • Meta-analysis of published results:

      • Systematic review of methodological differences

      • Statistical analysis of reported parameters

      • Identification of consistent trends across studies

Example reconciliation analysis for contradictory acyltransferase data:

StudyReported ActivityExperimental SystemPotential Explanation for Discrepancy
Study AHigh activity in vitroDetergent-solubilized enzymeOptimal detergent micelle environment
Study BLow activity in vitroSame enzyme preparationDifferent assay conditions or detection limits
Study CHigh activity in vivoComplementation assayCellular environment provides essential factors
Study DNo activity detectedIn vitro with purified componentsMissing cofactors or improper folding

Studies of related acyltransferases have demonstrated such discrepancies. For example, plsD from Clostridium butyricum complemented plsB-deficient E. coli in vivo, confirming its ability to synthesize 1-acyl-glycerol-3-phosphate, yet showed no detectable glycerol-3-phosphate acyltransferase activity in vitro with either acyl-ACP or acyl-CoA as substrates . This highlights the importance of considering multiple experimental approaches when characterizing enzyme function.

How can recombinant plsY be utilized in synthetic biology applications?

Recombinant plsY offers several applications in synthetic biology, ranging from basic research tools to practical biotechnology applications:

  • Membrane engineering applications:

    • Production of customized phospholipids with altered properties

    • Creation of bacterial strains with modified membrane compositions

    • Engineering of strains with increased tolerance to environmental stresses

    • Development of bacteria capable of producing specialty lipids

  • Metabolic engineering strategies:

    • Incorporation into synthetic phospholipid biosynthesis pathways

    • Use as a component in artificial cell systems

    • Integration with other engineered pathways for complex lipid production

    • Deployment in cell-free systems for lipid synthesis

  • Research applications:

    • Probe for membrane dynamics and lipid distribution

    • Tool for studying membrane protein-lipid interactions

    • Model system for enzyme evolution studies

    • Platform for screening potential antimicrobial compounds

  • Biotechnological applications:

    • Production of structured phospholipids for nutrition and medical applications

    • Generation of functionalized lipids for drug delivery systems

    • Creation of bacterial factories for sustainable lipid production

    • Development of biosensors incorporating engineered lipid membranes

Studies with related acyltransferases demonstrate the potential of these enzymes in synthetic biology applications. The ability of heterologous acyltransferases like plsD from Clostridium butyricum to functionally complement E. coli mutants illustrates the modularity of these enzymes and their potential utility in designed systems .

What are the key challenges in comparing acyltransferase activities across different studies?

Comparing acyltransferase activities across different studies presents several challenges that researchers must address:

  • Methodological variations:

    • Diverse assay formats (radiometric, spectrophotometric, fluorometric)

    • Different substrate preparations and concentrations

    • Varying buffer compositions and pH conditions

    • Temperature differences affecting enzyme kinetics

  • Enzyme preparation differences:

    • Variable purification methods affecting enzyme quality

    • Different fusion tags influencing activity and stability

    • Varying detergent/lipid environments for membrane proteins

    • Inconsistent storage conditions affecting enzyme integrity

  • Expression system variations:

    • Host strain differences affecting protein folding and modification

    • Expression level variability impacting specific activity calculations

    • Codon optimization differences between constructs

    • Inclusion body formation and refolding approaches

  • Standardization approaches:

    • Use of well-characterized reference enzymes across studies

    • Development of standardized assay conditions and reporting formats

    • Inclusion of detailed methodological descriptions

    • Cross-validation between different assay methods

One particular challenge observed in acyltransferase research is the discrepancy between in vitro and in vivo activities. For example, the plsD gene from Clostridium butyricum complemented a plsB-deficient E. coli strain in vivo, restoring its ability to synthesize 1-acyl-glycerol-3-phosphate, yet showed no detectable activity in vitro with either acyl-ACP or acyl-CoA as substrates . This highlights the complexity of these enzymes and the importance of considering multiple experimental approaches when characterizing their function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.