Recombinant Escherichia coli O7:K1 Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time estimates, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself. Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; ECIAI39_4310; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It participates in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC also aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of YidC in bacterial membrane protein biogenesis?

YidC functions as both a membrane protein insertase and a foldase in Escherichia coli. It assists in the insertion and proper folding of transmembrane proteins into the cytoplasmic membrane. YidC can operate through two primary mechanisms: (1) in conjunction with the Sec translocon to facilitate the insertion and folding of membrane proteins, and (2) independently as an insertase for so-called "YidC-only" substrates . Beyond its insertase activity, YidC also plays a critical role as a foldase that promotes the proper assembly of membrane protein complexes and can extend this function to the periplasmic domains of membrane proteins .

What techniques are most effective for studying YidC-substrate interactions at the molecular level?

Modern studies of YidC-substrate interactions employ a combination of complementary techniques:

  • Single-molecule force spectroscopy: Allows measurement of binding forces between YidC and substrate proteins at the individual molecule level .

  • Fluorescence spectroscopy: Enables real-time monitoring of conformational changes during substrate binding and insertion .

  • Molecular dynamics simulations: Provides atomistic insights into the structural dynamics of YidC-substrate interactions .

  • Water accessibility assays: The N-ethylmaleimide (NEM) reactivity assay can be used to assess water availability at specific sites of YidC in intact cells by strategically placing cysteine residues and measuring their reactivity .

  • Electrophysiology with reconstituted planar lipid bilayers: Useful for characterizing potential pore formation and ion conductance by YidC upon substrate binding .

These approaches have revealed that YidC binds the polypeptide of membrane protein Pf3 within 2 milliseconds with high conformational variability, then within 52 milliseconds, strengthens this binding and uses its cytoplasmic α-helical hairpin domain and hydrophilic groove to transfer the substrate to a membrane-inserted, folded state .

How can researchers effectively purify and reconstitute YidC for in vitro studies?

Purification and reconstitution of YidC typically follows this methodological approach:

  • Expression system selection: YidC can be expressed in E. coli K-12 strains carrying recombinant vectors .

  • Solubilization: Membrane proteins containing YidC are typically solubilized using detergents such as DDM (n-dodecyl β-D-maltoside) at concentrations of 0.03% in buffer containing glycerol .

  • Affinity purification: Metal affinity chromatography using TALON® Metal affinity resin with histidine-tagged YidC constructs is effective. The typical protocol involves:

    • Incubation with pre-equilibrated resin for 1 hour at 4°C

    • Washing with buffer containing 40 mM imidazole

    • Elution with buffer containing 200 mM imidazole

  • Storage considerations: Purified recombinant YidC should ideally be stored at -20°C/-80°C with 5-50% glycerol to maintain stability. The shelf life is approximately 6 months for liquid form and 12 months for lyophilized form at these temperatures . Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

Storage FormRecommended TemperatureShelf LifeAdditives
Liquid-20°C/-80°C6 months5-50% glycerol
Lyophilized-20°C/-80°C12 monthsN/A
Working aliquots4°CUp to 1 weekN/A

What is the evidence for YidC oligomerization, and how does this impact its function?

Multiple experimental approaches have provided evidence for YidC forming oligomers, particularly dimers:

  • AlphaFold modeling: While monomeric YidC structures have been reported, an AlphaFold parallel YidC dimer model reveals the presence of a pore structure that could explain ion conductance observations .

  • Blue Native PAGE (BN-PAGE): Analysis of native vesicles supports the existence of dimeric assemblies .

  • Fluorescence correlation spectroscopy (FCS): This technique has been used to assess the oligomeric state of reconstituted YidC in vesicles and inner membrane vesicles (IMVs) .

  • Single-molecule fluorescence photobleaching: Observations at this level support the existence of YidC dimers .

  • Crosslinking experiments: In vivo site-directed crosslinking provides further evidence for dimeric YidC assemblies .

The oligomeric state appears functionally significant as the dimeric model reveals a central pore lined by residues known to interact with nascent chains, including the conserved arginine . This suggests an alternative model for YidC-assisted insertion beyond the classical insertase mechanism.

How does YidC form an ion-conducting pore, and what triggers this activity?

Recent research has demonstrated that purified and reconstituted E. coli YidC can form an ion-conducting transmembrane pore upon specific triggering events . This pore formation activity is initiated by:

  • Ribosome binding: The interaction with ribosomes appears sufficient to induce pore formation in YidC-containing bilayers .

  • Ribosome-nascent chain complex (RNC) binding: YidC also shows channel activity in the presence of RNCs of natural YidC substrates like FoC .

The structural basis for this activity appears to involve the dimerization of YidC, as the AlphaFold parallel YidC dimer model reveals a central pore that could facilitate ion conductance. The conserved arginine residue and other residues known to interact with nascent chains line this putative pore, suggesting a mechanistic relationship between substrate handling and pore formation .

What are the key kinetic parameters of YidC-mediated membrane protein insertion?

The kinetics of YidC-mediated membrane protein insertion occur on a millisecond timescale, as revealed by single-molecule studies:

  • Initial binding phase: Within 2 milliseconds, the cytoplasmic α-helical hairpin of YidC binds the polypeptide of membrane proteins (such as Pf3) with high conformational variability and kinetic stability .

  • Strengthening phase: Within approximately 52 milliseconds, YidC strengthens its binding to the substrate .

  • Transfer phase: Following strengthened binding, YidC utilizes its cytoplasmic α-helical hairpin domain and hydrophilic groove to transfer the substrate to the membrane-inserted, folded state .

In the inserted state, membrane proteins like Pf3 exhibit low conformational variability, which is characteristic of transmembrane α-helical proteins . These rapid kinetics highlight the efficiency of YidC as an insertase and explain how it can facilitate the timely insertion of membrane proteins to prevent toxic aggregation.

How does YidC extend its foldase activity to periplasmic domains of membrane proteins?

YidC's function extends beyond mere insertion to include a foldase activity that can reach periplasmic domains of membrane proteins . This is particularly significant for proteins like penicillin binding proteins (PBPs), which contain one transmembrane segment and a large periplasmic domain involved in peptidoglycan synthesis .

Research has shown that in the absence of YidC, critical PBPs fail to fold correctly even when the total amount of protein in the membrane remains unaffected . This indicates that YidC's foldase activity extends beyond the transmembrane segments to influence the folding of associated periplasmic domains.

The mechanism likely involves:

  • Initial insertion assistance: YidC facilitates proper insertion of the transmembrane segment.

  • Transmembrane positioning: Correct positioning of the transmembrane segment by YidC creates an optimal orientation for the periplasmic domain.

  • Folding guidance: The hydrophilic cavity of YidC may provide a favorable environment that influences the initial folding trajectory of the periplasmic domain as it emerges from the membrane.

This extended foldase activity highlights YidC's roles beyond simple membrane insertion and explains its importance for the proper functioning of complex membrane proteins with extramembrane domains.

How are YidC homologs functionally conserved and divergent across different species?

YidC represents a universally conserved protein family with homologs present in all domains of life:

  • Bacterial homologs: YidC in E. coli and SpoIIIJ in B. subtilis

  • Mitochondrial homolog: Oxa1

  • Chloroplast homolog: Alb3

While these homologs share core functions in membrane protein insertion and folding, significant functional differences exist:

  • Arginine dependency: The cavity arginine residue in E. coli YidC is dispensable for the insertase activity of the Pf3 coat protein, whereas this residue is required when the same substrate is handled by Streptococcus mutans YidC2 . This suggests mechanistic differences between YidC homologs.

  • Cooperation with other factors: YidC homologs differ in their modes of cooperation with other cellular components, including the signal recognition particle and ribosomes .

  • Multiple functions: Each homolog can potentially have multiple functions and reaction mechanisms, adapting to the specific needs of their respective cellular environments .

The hydrophilic cavity within the membrane appears to be a common feature conserved across many family members, although the specific way this environment is utilized may differ between homologs .

What is the relationship between YidC in pathogenic E. coli strains and human extraintestinal pathogenic E. coli?

Comparative genomic analysis has revealed significant genetic overlap between avian pathogenic E. coli (APEC) and human extraintestinal pathogenic E. coli (ExPEC) strains, particularly those of serotypes O1, O2, and O18 . These strains, including E. coli O7:K1, share similar genetic characteristics and pathogenicity, with minimal host specificity .

Specifically for YidC:

  • Conservation in pathogenic strains: YidC is conserved across these pathogenic E. coli strains, suggesting its importance for bacterial fitness regardless of host environment.

  • Potential virulence factor: As YidC is crucial for proper membrane protein insertion and folding, it may indirectly contribute to pathogenicity by ensuring the proper integration of virulence factors into the bacterial membrane.

  • Zoonotic implications: The high virulence of APEC O1:K1 and O2:K1 serotypes in animal models of both avian colisepticemia and rat septicemia/meningitis suggests zoonotic potential . This highlights the possible role of conserved proteins like YidC in facilitating cross-species infections.

This relationship underscores the evolutionary conservation of essential cellular machinery like YidC even in divergent pathogenic strains adapted to different hosts.

What are the main technical challenges in expressing recombinant YidC, and how can they be addressed?

Expression of recombinant YidC presents several technical challenges:

  • Expression level regulation: Expression of membrane proteins like YidC in E. coli K-12 can be significantly lower than in wild-type strains. For instance, the amount of O7 LPS expressed in E. coli K-12 was considerably lower than that produced by the wild-type strain VW187 . This suggests potential challenges in achieving high expression levels of recombinant YidC.

  • Protein folding and insertion: As an integral membrane protein, YidC must be properly inserted into the membrane during expression. Overexpression can overwhelm the native insertion machinery.

  • Protein stability: Maintaining the stability of the purified recombinant YidC requires careful consideration of buffer components and storage conditions.

These challenges can be addressed through several strategies:

  • Optimized expression systems: Using specialized expression strains with enhanced membrane protein production capabilities.

  • Fusion partners: Addition of solubility-enhancing fusion tags that can be later removed.

  • Induction optimization: Fine-tuning of induction conditions (temperature, inducer concentration, and induction duration) to maximize properly folded protein yield.

  • Stabilization additives: Inclusion of glycerol (5-50%) in storage buffers to enhance stability .

  • Temperature management: Storage at -20°C/-80°C for long-term stability and avoiding repeated freeze-thaw cycles .

How can researchers verify the functional integrity of purified recombinant YidC?

Verifying the functional integrity of purified recombinant YidC is crucial for meaningful experimental outcomes. Several approaches can be employed:

  • Substrate binding assays: Using fluorescently labeled substrate proteins to assess binding kinetics and affinity, which should match the expected parameters (initial binding within 2 ms, strengthening within 52 ms) .

  • Pore formation assessment: Electrophysiological measurements to detect ion conductance upon ribosome or RNC binding, which indicates proper folding and functionality .

  • Reconstitution into proteoliposomes: Testing the ability of reconstituted YidC to insert model substrates into artificial membranes.

  • Water accessibility: Using the NEM reactivity assay to confirm the presence and proper formation of the water-accessible cavity, a hallmark of functional YidC .

  • Oligomerization assessment: BN-PAGE analysis to verify the ability of YidC to form the dimeric structures associated with its functional state .

A combination of these approaches provides comprehensive validation of the functional integrity of purified recombinant YidC before proceeding with more complex experiments.

What are the most promising areas for future research on YidC's mechanism of action?

Several key areas represent promising directions for advancing our understanding of YidC:

  • Structural dynamics during insertion: While static structures provide valuable insights, understanding the dynamic conformational changes of YidC during the substrate insertion process remains a critical area for investigation.

  • Substrate selection mechanisms: How YidC distinguishes between different substrates and the molecular basis for substrate specificity is not fully understood.

  • Dimeric vs. monomeric functions: Further clarification of the functional significance of YidC oligomerization and how the oligomeric state relates to different aspects of YidC function (insertase vs. foldase activities).

  • Cross-talk with other cellular machinery: The interplay between YidC and other components of the protein quality control system, including chaperones and proteases, represents an important area for future research.

  • Regulatory mechanisms: Understanding how YidC activity is regulated in response to cellular stress or changing environmental conditions could reveal new aspects of membrane protein homeostasis.

Addressing these questions will require the continued development and application of advanced techniques such as cryo-electron microscopy, single-molecule tracking in living cells, and computational modeling of the insertion process.

How might insights from YidC research translate to biotechnological applications?

Understanding YidC function has several potential biotechnological applications:

  • Enhanced membrane protein production: Optimization of YidC co-expression systems could improve the notoriously difficult production of membrane proteins for structural studies and pharmaceutical development.

  • Antimicrobial development: As YidC is essential for bacterial viability and has structural differences from its eukaryotic homologs, it represents a potential target for novel antimicrobials, particularly against resistant pathogens like E. coli O7:K1.

  • Synthetic biology applications: Engineered YidC variants could potentially be developed to insert non-native membrane proteins with desired properties, expanding the toolkit for synthetic biology approaches.

  • Protein engineering: Insights into how YidC facilitates membrane protein folding could inform the design of artificial membrane proteins with novel functions or improved stability.

  • Cell-free expression systems: Incorporation of purified YidC into cell-free protein synthesis platforms could enhance the production of functional membrane proteins for various applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.