Recombinant Escherichia coli O7:K1 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; ECIAI39_2426; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of the NuoK subunit in bacterial NADH-quinone oxidoreductase?

The NuoK subunit is the smallest mitochondrial DNA-encoded subunit of the proton-translocating NADH-quinone oxidoreductase (complex I) and serves as the Escherichia coli homologue of ND4L. Structural analyses reveal that NuoK spans the membrane with three linearly arranged α-helices connected by short loops. The subunit exhibits extensive interaction with the NuoN subunit, with its C terminus extending between NuoN and helix HL (an α-helix of NuoL that spans multiple subunits in the membrane domain anchoring near NuoN), forming many inter-subunit links . This positioning suggests NuoK plays a critical role in the stability and conformational coupling within the membrane domain of NDH-1.

Which amino acid residues in NuoK are most conserved and functionally significant?

Several highly conserved residues in NuoK have been identified as crucial for enzyme function. Most notably, two highly conserved glutamic acid residues (Glu-36 and Glu-72) located in the middle of the membrane in transmembrane helices TM2 and TM3 respectively are essential for activity . Additionally, the cytosolic loop-1 contains important residues, particularly KArg-25, which is well conserved across species. Experimental evidence demonstrates that mutations of Glu-36 lead to almost null activities of coupled electron transfer with concomitant loss of electrochemical gradient generation, while mutations of Glu-72 cause moderate reduction in activities . These results suggest that both membrane-embedded acidic residues are important for the coupling mechanism of NDH-1.

How does the positional flexibility of conserved glutamic acid residues affect NuoK function?

A remarkable characteristic of the conserved glutamic acid residues in NuoK is their positional flexibility. For KGlu-36 in TM2, mutations that relocated this residue to positions 32, 38, 39, and 40 (EAE2, EAE7, EAE8, and EAE9) largely preserved NDH-1 activities . Similarly, when KGlu-72 in TM3 was relocated, the EAE17 mutant, in which KGlu-72 was shifted upstream by one helix turn, sustained NDH-1 activities comparable to the wild type . These findings mirror similar observations with MGlu144 in the NuoM subunit, where only relocation to positions one helix turn downstream and upstream in the TM5 helix retained energy transducing activities . This characteristic was also reported for essential Asp-61 of the dicyclohexylcarbodiimide-binding subunit of E. coli ATP synthase, suggesting a common mechanism in proton-translocating membrane proteins.

How do mutations in NuoK affect the energy-transducing activities of NDH-1?

The energy-transducing activities of NDH-1 are differentially affected by mutations in specific regions of NuoK. For most mutations of KGlu-36 in TM2, the energy-transducing activities were almost completely suppressed, showing values similar to the E36A mutant . Exceptions occurred when the glutamate was relocated to positions one helix turn upstream or downstream. Similar results were obtained with KGlu-72 mutations in TM3, where most mutants displayed energy-coupled activities close to the E72A mutant, except for EAE17 (shift by one helix turn) . These findings suggest that precise positioning of acidic residues within the transmembrane helices is critical for proton translocation, but with some positional flexibility within the helical structure.

What techniques are recommended for site-directed mutagenesis of the nuoK gene?

Site-directed mutagenesis of the nuoK gene can be efficiently performed using homologous recombination techniques. The pKO3 system has been successfully employed for generating knockout and site-specific mutations in the NDH-1 operon . The procedure typically involves:

  • Construction of a knockout strain (e.g., KO-C) by replacing the target gene segment in the NDH-1 operon with a selectable marker

  • Generation of competent cells from the knockout strain

  • Transformation with plasmids containing the desired mutations (e.g., pKO3/nuoC with specific mutations)

  • Selection for recombination events

  • Verification of mutations by direct DNA sequencing

This approach allows for precise manipulation of the chromosomal gene while maintaining its native regulatory context .

How should researchers measure and analyze NDH-1 activities in NuoK mutants?

Multiple complementary assays are recommended for comprehensive analysis of NDH-1 activities in NuoK mutants:

  • dNADH-K₃Fe(CN)₆ reductase activity: Performed at 30°C with 80 μg of protein/ml of membrane samples in 10 mM potassium phosphate (pH 7.0), 1 mM EDTA, 10 mM KCN, and 1 mM K₃Fe(CN)₆. The reaction is initiated by adding 150 μM dNADH, with measurements followed at 420 nm .

  • dNADH-DB reductase activity: Conducted under similar conditions, but with 60 μM DB replacing K₃Fe(CN)₆, and measurements followed at 340 nm .

  • dNADH oxidase activity: Measured using the same basic conditions, but without KCN or DB in the reaction buffer .

These assays provide insights into different aspects of electron transfer within the complex, allowing for discrimination between defects in specific functional steps.

What approaches are effective for analyzing NDH-1 assembly in NuoK mutants?

Analysis of NDH-1 assembly in NuoK mutants requires multiple complementary techniques:

  • Immunoblotting: Using antibodies against various E. coli NDH-1 subunits (NuoB, NuoCD, NuoE, NuoF, NuoG, NuoI, NuoK, NuoM, and NuoL) to analyze subunit content .

  • Blue-native PAGE (BN-PAGE): Performed with careful consideration of detergent extraction conditions (0.5% or 1.0% dodecyl maltoside) as certain mutants may be sensitive to detergent extraction .

  • NADH dehydrogenase activity staining: Applied to BN-PAGE gels to visualize assembled and functional NDH-1. For mutants with reduced activity, extended incubation times (1-2 hours) may be necessary to visualize the NDH-1 band .

It is important to note that membrane preparation conditions can significantly impact results, and standardized protocols for growth and membrane vesicle preparation should be followed for reliable comparisons between mutants .

How does the three-dimensional structure of NuoK relate to its proton translocation function?

The NuoK subunit's structure features three linearly arranged α-helices spanning the membrane, with the conserved glutamic acid residues Glu-36 and Glu-72 positioned in TM2 and TM3, respectively . This arrangement places these acidic residues in proximity to the proposed proton translocation pathway. The extensive interaction between NuoK and NuoN, with the C-terminus of NuoK extending between NuoN and helix HL, suggests that conformational changes in NuoK could be transmitted to adjacent subunits . This structural arrangement supports the hypothesis that NuoK participates in a coordinated proton pumping mechanism involving multiple subunits in the membrane domain.

What is the relationship between NuoK and other membrane domain subunits in NDH-1?

NuoK shows significant sequence similarity to the MrpC subunit of multisubunit Na⁺/H⁺ antiporters, suggesting evolutionary and functional relationships between these proton-translocating membrane proteins . Within the NDH-1 complex, NuoK interacts extensively with the NuoN subunit and is positioned near the helix HL of NuoL . This arrangement places NuoK at a critical junction within the membrane domain, potentially allowing it to participate in long-range conformational coupling mechanisms that coordinate electron transfer in the peripheral arm with proton translocation in the membrane arm.

What controls should be included when studying NuoK mutants?

Proper experimental design for NuoK mutation studies should include several key controls:

  • Wild-type strain: Essential for baseline comparison of subunit content, assembly, and enzymatic activities .

  • Knockout-revertant strain: Generated using the wild-type gene for the recombination process to control for potential artifacts introduced during the genetic manipulation procedure .

  • Multiple activity assays: Including dNADH-K₃Fe(CN)₆ reductase, dNADH-DB reductase, and dNADH oxidase activities to provide a comprehensive view of NDH-1 function .

  • Assembly verification: Using both immunoblotting and BN-PAGE with activity staining to ensure proper complex formation .

  • Sequence verification: Direct DNA sequencing to confirm the introduction of the intended mutations without additional unintended changes .

How can researchers overcome detection challenges with low-activity NuoK mutants?

The detection of NDH-1 activity in low-activity NuoK mutants requires modified experimental approaches:

  • Extended incubation times: For BN-PAGE activity staining, increasing incubation time from the standard 5 minutes to 1-2 hours can reveal NDH-1 bands in mutants with severely reduced activity .

  • Optimized detergent extraction: Adjusting dodecyl maltoside concentration (0.5% or 1.0%) based on mutant sensitivity can improve recovery of intact complexes for analysis .

  • Increased protein loading: For activity assays and immunodetection, increasing the amount of membrane protein can help compensate for reduced signal intensity.

  • High-sensitivity detection methods: Employing more sensitive spectrophotometric or fluorometric techniques for enzyme activity measurements may be necessary for mutants with extremely low activities.

What are common pitfalls in interpreting NuoK mutation data?

Several common pitfalls should be avoided when interpreting data from NuoK mutation studies:

  • Assuming assembly defects: Many NuoK mutations affect activity without disrupting assembly, as demonstrated by the preservation of complex integrity in immunoblotting and BN-PAGE analyses .

  • Overlooking partial activities: Some mutations may selectively affect certain aspects of NDH-1 function while preserving others, necessitating multiple complementary activity assays for comprehensive evaluation .

  • Neglecting protein expression levels: Changes in NuoK expression or stability could influence observed activities independent of the mutation's direct effect on function.

  • Ignoring positional context: The functional impact of mutations can depend on their three-dimensional context within the assembled complex rather than simply their position within the primary sequence.

  • Failing to consider compensatory mechanisms: The bacterial respiratory system may adapt to NDH-1 deficiencies through alternative pathways or regulatory changes, potentially masking the full impact of NuoK mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.