Recombinant Escherichia coli O7:K1 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O7:K1 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Recombinant Escherichia coli O7:K1 p-hydroxybenzoic acid efflux pump subunit AaeA (AaeA) is a component of an efflux pump system in Escherichia coli that confers resistance to multiple antimicrobials by expelling a wide range of compounds, including antibiotics and toxic substances, from the bacterial cell . Efflux pumps are crucial in bacterial defense mechanisms, contributing to antimicrobial resistance . The AaeA subunit, along with other proteins, forms a complex that facilitates the extrusion of specific substrates, such as p-hydroxybenzoic acid (pHBA), out of the cell .

Genetic and Functional переименование of aaeA

The aaeA gene was initially identified as yhcQ in E. coli. Research has demonstrated that the yhcRQP gene cluster is upregulated when E. coli is treated with pHBA . Further studies revealed that yhcP encodes a protein belonging to the putative efflux protein family, while yhcQ encodes a protein of the membrane fusion protein family, and yhcR encodes a small protein without a known function . The yhcS gene, which is divergently transcribed upstream of yhcRQP, encodes a regulatory protein of the LysR family and regulates the expression of yhcRQP .

Due to their role in aromatic carboxylic acid efflux, the genes yhcS, yhcR, yhcQ, and yhcP were renamed aaeR, aaeX, aaeA, and aaeB, respectively . This renaming reflects their function in the aromatic carboxylic acid efflux system . The AaeAB efflux system is believed to serve as a "metabolic relief valve" to mitigate the toxic effects of imbalanced metabolism .

The AaeAB Efflux Pump System

The AaeAB efflux pump system in E. coli is involved in the efflux of aromatic carboxylic acids . The system consists of two main components:

  • AaeA: A membrane fusion protein .

  • AaeB: An efflux pump subunit .

The AaeAB system is regulated by AaeR, a LysR family regulatory protein, which controls the expression of the aaeAB genes in response to aromatic carboxylic acids .

Role in Antimicrobial Resistance and Metabolic Relief

Efflux pumps play a significant role in antimicrobial resistance by extruding antibiotics and other toxic compounds from the bacterial cell . The AaeAB efflux system contributes to this resistance mechanism by expelling specific substrates, thereby reducing their intracellular concentration . Furthermore, the AaeAB system is thought to act as a metabolic relief valve, alleviating the toxic effects of imbalanced metabolism . This function is particularly important in managing the levels of aromatic carboxylic acids, which can be toxic if accumulated within the cell .

Evolutionary Conservation and Physiological Functions

Efflux pumps, including AaeAB, are evolutionarily conserved in E. coli, with the majority of pumps encoded in the core genome . These pumps are crucial for the detoxification of endogenously synthesized substrates and maintaining pH homeostasis . The stability and conservation of efflux systems highlight their importance in the physiology and survival of E. coli .

Tables of Data

Because there are no tables in the provided documents, I am unable to comply with this aspect of your request.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; ECIAI39_3732; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFIIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the p-hydroxybenzoic acid efflux pump subunit AaeA and what is its role in E. coli?

The p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) is a membrane protein component of an efflux system in E. coli that facilitates the export of p-hydroxybenzoic acid and potentially other aromatic compounds from the bacterial cell. As part of bacterial efflux machinery, it contributes to cellular detoxification processes by removing potentially harmful compounds from the intracellular environment. The full-length AaeA protein consists of 310 amino acids in E. coli O7:K1 (strain IAI39/ExPEC) with the UniProt accession number B7NLF9 . This protein belongs to a family of membrane transport proteins that play crucial roles in bacterial survival mechanisms against environmental stressors, including certain antibiotics and toxic compounds.

What are the alternative names and genetic identifiers for AaeA in different E. coli strains?

AaeA has several alternative names and genetic identifiers across E. coli strains:

StrainGene NameAlternative NamesLocus Tags
E. coli (general)aaeApHBA efflux pump protein A, p-hydroxybenzoic acid efflux subunit AaeAyhcQ, ECK3230, JW3210
E. coli O7:K1aaeApHBA efflux pump protein AECIAI39_3732
E. coli O127:H6aaeApHBA efflux pump protein A-
E. coli O157:H7aaeApHBA efflux pump protein A-
Other strainsaaeAp-hydroxybenzoic acid efflux system componentEcolC_0465

The gene encoding AaeA is conserved across E. coli strains but may have different locus tags depending on the specific strain annotation . Understanding these variations is important when designing primers for gene amplification or when searching genomic databases.

What expression systems are most effective for producing recombinant AaeA protein?

Several expression systems have been documented for the production of recombinant AaeA, each with distinct advantages:

Expression HostAdvantagesConsiderations
E. coliHigh yield, fast growth, cost-effective, easy genetic manipulationMay form inclusion bodies with membrane proteins, limited post-translational modifications
YeastEukaryotic post-translational modifications, proper folding of complex proteinsLonger production time, different codon usage, glycosylation patterns
BaculovirusAdvanced eukaryotic modifications, high expression levels for complex proteinsTechnical complexity, higher cost, longer production time
Mammalian CellMost authentic post-translational modifications, functional protein foldingHighest cost, lowest yield, most complex system maintenance

What storage conditions ensure optimal stability of recombinant AaeA?

For optimal stability of recombinant AaeA protein:

  • Store concentrated stock in Tris-based buffer with 50% glycerol at -20°C, or at -80°C for extended storage periods .

  • Avoid repeated freeze-thaw cycles as these can compromise protein integrity and function.

  • For routine experiments, prepare working aliquots and store at 4°C for up to one week .

  • Consider adding protease inhibitors to prevent degradation during storage.

What purification strategies yield the highest purity of recombinant AaeA?

For achieving ≥85% purity of recombinant AaeA as typically determined by SDS-PAGE , the following purification strategy is recommended:

  • Initial Capture: Utilize affinity chromatography based on the fusion tag incorporated during recombinant production (His-tag, GST, etc.)

  • Intermediate Purification: Apply ion exchange chromatography to separate AaeA from proteins with different charge properties

  • Polishing Step: Implement size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations

  • Membrane Protein Considerations: Include appropriate detergents throughout the purification process to maintain protein solubility and native conformation

The choice of detergent is critical for membrane proteins like AaeA, with mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) often yielding best results for maintaining protein stability and function during purification.

How can researchers assess the functional activity of purified AaeA?

To evaluate whether purified recombinant AaeA retains its native functional activity, researchers should employ multiple complementary approaches:

  • Substrate Transport Assays: Measure the transport of p-hydroxybenzoic acid across membranes in reconstituted proteoliposomes containing purified AaeA

  • ATPase Activity Assays: If AaeA function is coupled to energy consumption, measure ATP hydrolysis rates in the presence and absence of transport substrates

  • Binding Assays: Use isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to quantify binding affinities between AaeA and its substrates

  • Complementation Studies: Express recombinant AaeA in efflux pump-deficient bacterial strains and measure restored resistance to toxic compounds

These functional assays should be performed under physiologically relevant conditions, with careful attention to pH, ionic strength, and membrane composition, which can significantly impact efflux pump activity.

How does AaeA contribute to antibiotic resistance mechanisms in E. coli?

While AaeA is primarily characterized as a p-hydroxybenzoic acid efflux pump component, its role in broader antibiotic resistance must be considered within the context of bacterial efflux systems:

  • AaeA may function as part of a complex that exports certain antibiotics or their metabolites, reducing their intracellular concentration below effective levels.

  • Although not as extensively studied as the AcrAB-TolC system (which is considered more clinically relevant for antibiotic resistance), the AaeA-containing efflux system likely contributes to the intrinsic resistance of E. coli to specific compounds .

  • Overexpression of efflux pump components, including potentially AaeA, can be induced upon exposure to antibiotics, contributing to adaptive resistance mechanisms.

Research indicates that RND efflux pumps are the most clinically relevant in Gram-negative bacteria, and over 50 efflux inhibitors targeting such systems have been described . Understanding AaeA's specific contributions to this process could identify novel targets for combination therapies aimed at overcoming antibiotic resistance.

What methods can be used to study AaeA inhibition for antimicrobial development?

When investigating AaeA as a potential target for efflux pump inhibitors to restore antibiotic efficacy:

  • High-throughput Screening: Develop fluorescent substrate-based assays to identify compounds that inhibit AaeA-mediated transport

  • Reporter Gene Assays: Similar to the approach used for AcrAB-TolC inhibitor screening, develop GFP reporter systems using promoters regulated in response to efflux pump inhibition

  • Structural Studies: Employ cryo-EM or X-ray crystallography to identify potential binding sites for inhibitor design, similar to approaches used for AcrB inhibitors

  • Combination Testing: Assess potential inhibitors in combination with antibiotics to quantify potentiation effects through checkerboard assays

Recent research has demonstrated that efflux pump inhibitors can effectively reverse antibiotic resistance mediated by overexpression of efflux systems like AcrAB-TolC, suggesting a similar approach could be effective for AaeA-containing efflux systems .

How does the expression of AaeA respond to different environmental stressors?

The regulation of efflux pump components often responds to environmental signals and stressors:

StressorExpected Effect on AaeA ExpressionRegulatory Mechanism
Aromatic compoundsUpregulationLikely involves specific transcription factors
AntibioticsPossible upregulationMay involve stress response pathways
pH changesConditional expressionAcid/base stress response systems
Oxidative stressPotential upregulationROS-responsive regulators
Nutrient limitationComplex regulationGrowth phase-dependent expression

Similar to other efflux systems, AaeA expression may be regulated by transcription factors that respond to the presence of pump substrates or general stress conditions. For instance, research on the AcrAB-TolC system has shown that transcription factors like RamA and MarR play important roles in regulating efflux pump expression in response to environmental stimuli . Mutations in these regulators can lead to constitutive overexpression of efflux pumps, contributing to antimicrobial resistance.

What structural features of AaeA are critical for its efflux pump function?

Based on the amino acid sequence information for AaeA from E. coli O7:K1 , several structural features likely contribute to its function:

  • Transmembrane Domains: The protein likely contains multiple membrane-spanning regions that form a channel for substrate transport

  • Substrate Binding Pocket: Specific residues create a binding site with affinity for p-hydroxybenzoic acid and potentially other aromatic compounds

  • Protein-Protein Interaction Domains: Regions that mediate association with other components of the efflux machinery

  • Conformational Change Elements: Structural elements that facilitate the alternating access mechanism typical of transport proteins

Understanding these structural features requires advanced techniques like site-directed mutagenesis followed by functional assays to identify essential residues. Comparative analysis with better-characterized efflux pump components like AcrB can provide insights into functional domains, as research has shown conserved mechanisms across different efflux systems .

What are the major challenges in expressing functional membrane proteins like AaeA and how can they be overcome?

Membrane proteins like AaeA present significant expression and purification challenges:

ChallengeSolution ApproachSuccess Indicators
Toxicity to host cellsUse tightly regulated expression systems; low-copy number vectorsImproved host cell viability
Inclusion body formationLower induction temperature (16-20°C); specialized E. coli strains (C41, C43); fusion partnersIncreased proportion of soluble protein
Improper membrane insertionUse of specialized secretion tags; optimization of membrane targeting sequencesCorrect localization in membrane fractions
Limited yieldOptimization of media composition; fed-batch fermentationHigher protein yield per culture volume
Protein aggregationAppropriate detergent selection for extraction and purificationMonodisperse protein preparation

Recent advances in recombinant protein production in E. coli have addressed several of these challenges through improved expression strategies and host strain engineering . Research has shown that controlling translation rate is particularly important for achieving maximal yields of functional exogenous proteins, especially for complex membrane proteins like efflux pump components.

How can researchers distinguish between specific inhibition of AaeA and non-specific membrane effects when studying potential inhibitors?

When evaluating compounds that potentially inhibit AaeA function, distinguishing between specific inhibition and non-specific membrane disruption is crucial:

  • Membrane Integrity Assays: Perform fluorescent dye leakage assays to rule out general membrane permeabilization effects

  • Control Transport Proteins: Test effects on unrelated membrane transporters to confirm specificity

  • Direct Binding Studies: Demonstrate direct binding using purified AaeA through techniques like isothermal titration calorimetry or surface plasmon resonance

  • Structure-Activity Relationship Analysis: Develop structural analogs with varying potency to establish correlation between chemical structure and inhibitory activity

  • Resistance Development: Analyze resistance mutations that specifically map to the AaeA gene

This methodological approach is particularly important as research has shown that some compounds initially identified as efflux inhibitors (e.g., PAβN) actually have dual actions including membrane permeabilization effects .

How might artificial intelligence approaches contribute to AaeA research and inhibitor development?

Artificial intelligence and machine learning approaches offer promising avenues for advancing AaeA research:

  • Structural Prediction: AI-powered tools can predict protein structures and functional domains when experimental structures are unavailable

  • Virtual Screening: Machine learning algorithms can screen virtual compound libraries to identify potential AaeA inhibitors

  • Systems Biology Integration: AI can help integrate AaeA function into broader bacterial metabolic networks

  • Resistance Prediction: Models can predict mutations likely to confer resistance to newly developed inhibitors

What synergistic approaches combining efflux pump inhibition with other antimicrobial strategies show the most promise?

Research into combination approaches targeting bacterial efflux systems alongside other mechanisms shows several promising directions:

  • Efflux Inhibitor + Antibiotic Combinations: Pairing AaeA inhibitors with antibiotics that are normally effluxed to restore their effectiveness

  • Dual-Target Inhibitors: Developing compounds that simultaneously inhibit AaeA and disrupt other bacterial survival mechanisms

  • Membrane Disruptors + Efflux Inhibitors: Careful combinations that exploit synergy between subtle membrane perturbation and efflux inhibition

  • Regulatory Network Targeting: Approaches that simultaneously inhibit efflux and downregulate expression of pump components

Studies have shown that when RND efflux pumps are inhibited or inactivated, some unrelated mechanisms of drug resistance can occur, but these typically do not confer clinically relevant levels of resistance . This suggests that efflux pump inhibition strategies can be effective even if bacteria attempt to compensate through alternative mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.