Recombinant Escherichia coli O7:K1 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Genetic Insights

Phosphoglycerol transferase I catalyzes the glycerophosphorylation of MDOs, which are periplasmic glucans involved in osmoregulation . Genetic studies using mdoB mutants (e.g., mdoB::Tn10) demonstrate:

  • Loss of activity: Mutants lack phosphoglycerol transferase I activity (<0.05 nmol/h per mg protein vs. 6.0 in wild type) .

  • MDO composition: Mutant MDOs contain <3% phosphoglycerol compared to wild type .

  • Phenotypic effects: mdoB mutants exhibit arbutin resistance and growth inhibition under osmotic stress .

Role in Bacterial Physiology

MDOs modified by phosphoglycerol residues are critical for:

  • Osmoregulation: Maintaining periplasmic osmotic balance under environmental stress .

  • Membrane integrity: Interactions with phospholipids stabilize the cell envelope .

While MDOs are not directly linked to the K1 capsule (a key virulence factor in E. coli O7:K1 ), their synthesis may indirectly support survival in host environments.

Research Applications

Recombinant O7:K1 phosphoglycerol transferase I is used to:

  • Study MDO biosynthesis pathways .

  • Investigate membrane biogenesis in pathogenic E. coli strains .

  • Develop inhibitors targeting bacterial stress-response systems .

Comparative Data from Mutant Studies

The table below contrasts MDO composition and enzyme activity in wild-type and mdoB mutants :

StrainPhosphoglycerol Transferase I Activity (nmol/h/mg)Phosphoglycerol Content (mol/mol MDO)
Wild-type (AB1133 mdoB+)6.02.0
mdoB::Tn10 mutant<0.090.05

Therapeutic Potential

Though not directly linked to the K1 capsule, disrupting MDO synthesis via mdoB inhibition could impair bacterial resilience in host environments. This approach complements strategies targeting the K1 capsule (e.g., depolymerases like EndoE) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; ECIAI39_4832; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLAAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSRTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKAIWKGKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
This protein facilitates the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Phosphoglycerol transferase I (mdoB) in E. coli?

Phosphoglycerol transferase I, encoded by the mdoB gene, is an enzymatic protein located in the inner cytoplasmic membrane of Escherichia coli. The primary function of this enzyme is to catalyze the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) or to model substrates such as arbutin (p-hydroxyphenyl-beta-D-glucoside). This catalytic reaction produces a phosphoglycerol diester derivative of MDOs or arbutin, along with sn-1,2-diglyceride as a byproduct. The active site of Phosphoglycerol transferase I is positioned on the outer aspect of the inner membrane, allowing it to interact with substrates in the periplasmic space. This positioning enables the enzyme to transfer phosphoglycerol residues to arbutin when it is added to the growth medium .

To investigate this function experimentally, researchers typically use genetic approaches involving mdoB mutants that lack phosphoglycerol transferase I activity. These mutants produce MDOs that are devoid of phosphoglycerol residues, confirming the enzyme's role in the modification of these periplasmic glucans .

How can I verify successful expression of recombinant mdoB in laboratory strains?

Verification of recombinant mdoB expression requires a multi-faceted approach combining genetic and biochemical methods. Begin by confirming the presence of the mdoB gene using PCR amplification with specific primers targeting conserved regions of the gene. While mdoB itself is not commonly used in multiplex PCR detection systems, the principles applied to other E. coli genes can be adapted. For example, you can design primers with 40%-55% GC content, 17-20 bp in length, targeting conserved regions identified through multiple sequence alignment of mdoB sequences .

For protein-level verification, perform Western blot analysis using antibodies specific to Phosphoglycerol transferase I or to an epitope tag if one was incorporated into your recombinant construct. Functional verification is equally important - this can be accomplished through an enzymatic activity assay measuring the transfer of phosphoglycerol residues from phosphatidylglycerol to arbutin, with the reaction products detected using thin-layer chromatography or mass spectrometry .

The most definitive verification comes from demonstrating that your recombinant protein complements an mdoB mutant strain. In a complementation assay, introduction of functional recombinant mdoB should restore the wild-type phenotype, including phosphoglycerol modification of MDOs and arbutin sensitivity in a dgk background .

What genetic background is recommended for optimal mdoB expression studies?

For mdoB expression studies, the genetic background of your E. coli strain requires careful consideration. Wild-type E. coli strains already contain the native mdoB gene (mapped near minute 99 on the E. coli chromosome), which could interfere with recombinant studies through competitive or compensatory effects . Therefore, an mdoB deletion strain is often the preferred genetic background, as it provides a clean system for studying the recombinant protein without interference from the native enzyme.

If studying the effects of Phosphoglycerol transferase I activity on cell physiology, consider using strains with mutations in related pathways. For instance, dgk mutants (defective in diglyceride kinase) accumulate sn-1,2-diglyceride when Phosphoglycerol transferase I is active in the presence of arbutin, resulting in growth inhibition. This creates a selection system where cells lacking Phosphoglycerol transferase I activity (mdoB mutants) show arbutin resistance .

For protein expression optimization, standard laboratory strains like BL21(DE3) or its derivatives are recommended due to their reduced protease activity and controlled expression systems. When studying physiological roles, consider using strains closer to wild-type E. coli or clinically relevant strains like O7:K1 if investigating virulence-related functions.

What are the most reliable methods for measuring Phosphoglycerol transferase I activity?

Measuring Phosphoglycerol transferase I activity requires carefully designed assays that track the enzyme's ability to transfer phosphoglycerol residues from phosphatidylglycerol to acceptor molecules. The most widely used approach involves a two-component assay system with the following methodology:

In Vitro Enzymatic Assay Protocol:

  • Prepare membrane fractions from E. coli cells expressing mdoB through ultracentrifugation (100,000 × g for 1 hour) after cell disruption.

  • Incubate membrane fractions (50-100 μg protein) with:

    • Phosphatidylglycerol (labeled with 32P or a fluorescent tag)

    • Acceptor substrate (purified MDOs or arbutin)

    • Buffer (typically 50 mM HEPES, pH 7.5, 10 mM MgCl2)

  • Run the reaction at 30°C for 30-60 minutes

  • Extract reaction products using chloroform/methanol (2:1 v/v)

  • Analyze products by thin-layer chromatography or HPLC

For in vivo assessment, researchers can employ the arbutin sensitivity test based on the observation that dgk mutants accumulate sn-1,2-diglyceride (a product of the Phosphoglycerol transferase I reaction) when grown with arbutin, leading to growth inhibition. In this approach:

  • Culture dgk mutant E. coli strains in media with and without arbutin (typically 10 mM)

  • Monitor growth over 24 hours by measuring optical density

  • Quantify growth inhibition as a proxy for Phosphoglycerol transferase I activity

  • Include mdoB/dgk double mutants as negative controls

This methodology allows for reliable quantification of enzyme activity in both recombinant systems and natural isolates, providing insights into the functional expression of mdoB.

How can I optimize PCR-based detection of the mdoB gene in environmental or clinical samples?

While the mdoB gene itself is not typically the primary target for E. coli detection in environmental or clinical samples, the principles of multiplex PCR optimization can be applied to develop a sensitive and specific detection method. Based on proven approaches for other E. coli genes, the following methodology is recommended:

Multiplex PCR Optimization for mdoB Detection:

  • Primer Design Strategy:

    • Extract mdoB sequences from complete E. coli genomes in the NCBI database

    • Perform multiple sequence alignment using MAFFT (FFT-NS-2 method)

    • Identify conserved regions with 40-55% GC content

    • Design primers (17-20 bp) targeting these regions

    • Ensure primer properties allow compatibility in multiplex reactions

  • Reaction Optimization:

    • Test primer concentrations ranging from 0.1-0.5 μM

    • Optimize annealing temperature (typically 55-62°C)

    • Adjust MgCl2 concentration (1.5-3.5 mM)

    • Consider addition of enhancers (DMSO, betaine) if needed

  • Validation Parameters:

    • Sensitivity: Test against diverse E. coli strains (aim for >95% detection)

    • Specificity: Test against non-E. coli Enterobacteriaceae (aim for >99%)

    • Repeatability: Perform 10 replicates with identical conditions

    • Reproducibility: Test across different days/equipment

    • Analytical sensitivity: Determine minimum detectable DNA (typically 2-10 ng)

For environmental samples, it's advisable to first use microbiological methods (selective media like MacConkey or CHROMagar) to isolate suspected E. coli colonies before performing PCR confirmation, as this combined approach yields the most reliable diagnostic results .

What protein purification strategy yields highest activity for recombinant Phosphoglycerol transferase I?

Purification of active Phosphoglycerol transferase I presents significant challenges due to its membrane-associated nature. The following comprehensive strategy has been developed based on successful approaches for similar membrane proteins:

Optimized Purification Protocol:

  • Expression System Selection:

    • E. coli BL21(DE3) with pET-based vectors

    • C-terminal His6-tag to minimize interference with signal sequences

    • Temperature-reduced expression (16-20°C) to enhance proper folding

  • Membrane Preparation:

    • Harvest cells at mid-log phase (OD600 ~0.6-0.8)

    • Resuspend in buffer containing 50 mM HEPES pH 7.5, 300 mM NaCl, 10% glycerol

    • Disrupt cells via French press or sonication

    • Remove unbroken cells and debris (10,000 × g, 15 min)

    • Collect membrane fraction (100,000 × g, 1 hour)

  • Solubilization and Purification:

    • Solubilize membranes with mild detergents (0.5-1% n-dodecyl-β-D-maltoside)

    • Perform immobilized metal affinity chromatography (IMAC)

    • Apply detergent gradient purification to maintain protein activity

    • Consider size exclusion chromatography as a final polishing step

  • Activity Preservation:

    • Include phospholipids (0.01-0.05% phosphatidylglycerol) in all buffers

    • Add stabilizing agents: glycerol (10-20%) and reducing agents (5 mM DTT or 2 mM β-mercaptoethanol)

    • Store in small aliquots at -80°C with minimal freeze-thaw cycles

This strategy typically yields protein with >80% purity and preserved enzymatic activity, suitable for both functional studies and structural investigations of Phosphoglycerol transferase I.

How does mdoB mutation impact bacterial response to osmotic stress?

Phosphoglycerol transferase I (mdoB) plays a significant role in the bacterial response to osmotic stress through its modification of membrane-derived oligosaccharides (MDOs). When E. coli encounters low osmolarity environments, MDOs accumulate in the periplasmic space to balance osmotic pressure. The phosphoglycerol modification catalyzed by mdoB affects the physiochemical properties of these MDOs, influencing their function in osmoadaptation.

Impact of mdoB Mutation on Osmotic Response:

ParameterWild-type E. colimdoB MutantSignificance
MDO Phosphoglycerol Content1-2 residues per moleculeAbsentAlters MDO charge distribution
Growth in Low OsmolarityNormalModerately impairedIndicates role in adaptation
Periplasmic OsmolarityWell-regulatedSub-optimal regulationAffects cellular homeostasis
Membrane PermeabilityNormalSlightly increasedImpacts cellular integrity
Antibiotic SusceptibilityReference levelIncreased for cationic antibioticsPotential clinical significance

Methodologically, this relationship can be investigated by comparing wild-type and mdoB mutant strains under various osmotic conditions. Techniques include growth curve analysis in media of different osmolarities (50-500 mOsm), measuring MDO content and composition through extraction and analysis by HPLC or mass spectrometry, and assessing membrane integrity through fluorescent dye penetration assays .

The absence of phosphoglycerol modifications in mdoB mutants results in MDOs with altered charge properties, affecting their interaction with other periplasmic components and potentially disrupting the osmotic balance maintenance mechanisms. This demonstrates that mdoB's role extends beyond simple MDO modification to influencing fundamental cellular responses to environmental stresses.

What is the relationship between Phosphoglycerol transferase I activity and E. coli pathogenicity?

The relationship between Phosphoglycerol transferase I activity and E. coli pathogenicity represents a complex intersection of membrane physiology and virulence. While direct evidence linking mdoB specifically to virulence in O7:K1 strains is limited, several mechanistic connections can be established through experimental approaches:

Methodological Approaches to Investigate mdoB-Pathogenicity Relationship:

  • Infection Models:

    • Compare wild-type and mdoB mutant strains in cellular invasion assays

    • Evaluate colonization efficiency in animal models

    • Measure survival rates and bacterial loads in tissues

  • Membrane Integrity Analysis:

    • Assess outer membrane vesicle (OMV) production and composition

    • Measure lipopolysaccharide (LPS) organization and presentation

    • Evaluate membrane fluidity under host-mimicking conditions

  • Host-Pathogen Interaction Studies:

    • Measure resistance to antimicrobial peptides

    • Evaluate recognition by host immune receptors

    • Assess adhesion to specific host cell types

The pathogenic potential of E. coli strains, particularly those causing extraintestinal infections, depends significantly on their ability to adapt to diverse host environments. Phosphoglycerol transferase I contributes to this adaptation by modifying membrane-derived oligosaccharides, which influences membrane properties and potentially affects the presentation of virulence factors .

E. coli O7:K1 strains are particularly relevant in this context as they are associated with neonatal meningitis, where the ability to cross the blood-brain barrier is critical. The K1 capsule is a primary virulence determinant, and its proper display and function may be influenced by membrane composition and organization, which are affected by mdoB activity .

How does the interplay between mdoB and other membrane modification enzymes affect cellular physiology?

The cellular envelope of E. coli represents a complex, dynamic structure where multiple enzymatic systems work in concert to maintain membrane integrity and function. Phosphoglycerol transferase I (mdoB) operates within this network, with its activity both influencing and being influenced by other membrane modification systems.

Methodological Framework for Studying Enzymatic Interplay:

To investigate these interactions, researchers employ a multi-faceted approach:

  • Genetic Interaction Analysis:

    • Create single and combinatorial mutations in mdoB and related genes

    • Perform synthetic genetic array (SGA) analysis to identify genetic interactions

    • Quantify epistatic relationships through growth phenotypes

  • Membrane Composition Profiling:

    • Lipidomic analysis of membrane composition in various genetic backgrounds

    • Characterization of MDO modifications using mass spectrometry

    • Tracking phospholipid turnover using radioisotope labeling

  • Protein-Protein Interaction Studies:

    • Bacterial two-hybrid screens to identify physical interactions

    • Co-immunoprecipitation of membrane protein complexes

    • Fluorescence resonance energy transfer (FRET) for in vivo interaction detection

Key Enzymatic Relationships:

EnzymeRelationship with mdoBMethodological ApproachPhysiological Impact
Diglyceride Kinase (dgk)Metabolizes mdoB reaction productGrowth inhibition in dgk/arbutin systemLipid homeostasis
OpgH/OpgG (MDO synthesis)Provides substrates for mdoBRadioactive labeling of MDOsPeriplasmic glucan production
LPS modification enzymesParallel membrane modificationMembrane integrity assaysOuter membrane organization
Phospholipid biosynthesis enzymesProvide phosphatidylglycerol substratePhospholipid profilingMembrane phospholipid balance

The interplay between these systems creates a regulatory network that allows E. coli to adapt its membrane properties in response to environmental changes. For instance, the relationship between mdoB and dgk demonstrates how metabolic cycles involving membrane components are interconnected, as evidenced by the accumulation of diglyceride in dgk mutants when mdoB is active in the presence of arbutin .

Why might recombinant mdoB expression result in toxicity to the host cell?

Recombinant expression of membrane proteins like Phosphoglycerol transferase I (mdoB) often encounters toxicity issues that can significantly impact experimental outcomes. Understanding the mechanisms behind this toxicity and implementing strategic solutions can improve expression success rates and protein yield.

Mechanisms of mdoB-Related Toxicity:

  • Membrane Stress: Overexpression of mdoB can disrupt membrane integrity by altering phospholipid homeostasis. The enzyme utilizes phosphatidylglycerol as a substrate, potentially depleting this essential phospholipid from the membrane when overexpressed .

  • Metabolic Imbalance: The production of sn-1,2-diglyceride as a byproduct of mdoB activity can accumulate to toxic levels, especially in strains with compromised diglyceride metabolism (similar to the dgk mutation situation) .

  • Protein Misfolding: Improper folding or membrane insertion of mdoB can trigger cellular stress responses, including the envelope stress response.

Methodological Solutions:

ProblemExperimental ApproachImplementation Strategy
Membrane StressControlled expression systemsUse tunable promoters (e.g., rhamnose-inducible) with low inducer concentrations
Membrane-optimized strainsEmploy C41(DE3) or C43(DE3) strains designed for membrane protein expression
Metabolic ImbalanceMetabolic engineeringCo-express dgk to process excess diglyceride
Media optimizationSupplement with specific phospholipids to maintain membrane balance
Protein MisfoldingFusion partnersIncorporate fusion tags that enhance folding (e.g., MBP, SUMO)
Chaperone co-expressionCo-express specialized membrane protein chaperones (FtsH, YidC)
Temperature reductionExpress at 16-20°C to slow folding and improve accuracy

When troubleshooting expression toxicity, a systematic approach is recommended: first establish a tightly controlled induction system, then optimize growth conditions (temperature, media composition), and finally consider genetic modifications to the expression strain or the protein construct itself to mitigate specific stress mechanisms.

How can I distinguish between enzymatic activity of native and recombinant Phosphoglycerol transferase I?

Distinguishing between native and recombinant Phosphoglycerol transferase I activity presents a methodological challenge crucial for accurate experimental interpretation. Several approaches can be employed to differentiate these activities and ensure experimental validity:

Differentiation Strategies:

  • Genetic Background Selection:

    • Use mdoB deletion strains as expression hosts to eliminate native activity

    • Verify complete absence of native mdoB through PCR and functional tests before introducing recombinant constructs

  • Protein Tagging Approaches:

    • Incorporate affinity tags (His, FLAG, etc.) into recombinant mdoB

    • Perform activity assays after specific purification of tagged protein

    • Use tag-specific antibodies in activity immunoprecipitation assays

  • Biochemical Discrimination:

    • Introduce subtle mutations that alter substrate specificity but maintain activity

    • Design assays with modified substrates that only recombinant enzyme can process

    • Exploit differences in inhibitor sensitivity between native and engineered variants

  • Spatiotemporal Separation:

    • Use inducible promoters to express recombinant mdoB at specific growth phases

    • Compare activity profiles between induced and non-induced conditions

    • Fractionate cellular components to isolate compartment-specific activity

Analytical Protocol for Discrimination:

  • Prepare membrane fractions from cells expressing both native and recombinant mdoB

  • Subject fractions to immobilized metal affinity chromatography if recombinant protein is His-tagged

  • Perform parallel activity assays on:

    • Total membrane fraction (native + recombinant activity)

    • Affinity-purified fraction (predominantly recombinant activity)

    • Flow-through fraction (predominantly native activity)

  • Quantify relative contributions through specific activity calculations

This methodological approach allows researchers to confidently attribute observed enzymatic activities to either native or recombinant Phosphoglycerol transferase I, enhancing the reliability of functional studies and enzyme characterization experiments.

What controls should be included in experiments investigating mdoB function?

Robust experimental design for investigating Phosphoglycerol transferase I (mdoB) function requires carefully selected controls to ensure valid interpretation of results. The following controls address different aspects of experimental validity:

Essential Controls for mdoB Research:

  • Genetic Controls:

    • Positive control: Wild-type E. coli strain with confirmed mdoB activity

    • Negative control: Isogenic mdoB deletion strain

    • Complementation control: mdoB deletion strain transformed with functional mdoB gene

    • Vector control: mdoB deletion strain transformed with empty expression vector

  • Biochemical Activity Controls:

    • Substrate controls: Reactions without phosphatidylglycerol or without acceptor substrate

    • Enzyme controls: Heat-inactivated enzyme preparations

    • Specificity controls: Related enzymes with different substrate preferences

    • Inhibitor controls: Known inhibitors of similar enzymes or general phospholipid transfer inhibitors

  • Expression System Controls:

    • Induction controls: Non-induced samples of inducible expression systems

    • Growth phase controls: Samples from different bacterial growth phases

    • Media controls: Expression in different media compositions

    • Stress controls: Expression under various environmental stresses

  • Analytical Controls:

    • Standard curves: Purified reaction products at known concentrations

    • Internal standards: Spiked samples with known quantities of reaction products

    • Matrix controls: Sample buffer with all components except enzyme and substrates

    • Instrumental controls: System suitability tests for analytical equipment

Experimental Design with Control Integration:

Experiment TypeEssential ControlsJustificationImplementation
Gene ExpressionmdoB deletion, vector-onlyDistinguishes specific effectsParallel growth and analysis
Enzyme ActivityNo enzyme, heat-inactivatedConfirms enzymatic natureInclude in activity assay plate
Phenotypic AnalysisComplemented strainVerifies phenotype is mdoB-specificInclude in all phenotypic tests
Membrane AnalysisIsogenic strains with different mdoB statusLinks membrane changes to mdoBPaired sample analysis

How is structural biology advancing our understanding of Phosphoglycerol transferase I mechanism?

Structural biology approaches are providing unprecedented insights into the molecular mechanism of Phosphoglycerol transferase I, revealing how this enzyme catalyzes the transfer of phosphoglycerol residues to membrane-derived oligosaccharides. Recent methodological advances in membrane protein structural determination have accelerated progress in this area.

Methodological Approaches in Structural Investigation:

  • X-ray Crystallography Adaptations:

    • Lipidic cubic phase crystallization

    • Detergent screening optimization

    • Fusion protein approaches to enhance crystallization

    • Fragment-based crystallography for functional domains

  • Cryo-Electron Microscopy Techniques:

    • Single-particle analysis of detergent-solubilized protein

    • Lipid nanodisc reconstitution for near-native environment

    • Subtomogram averaging for in situ structural analysis

    • Time-resolved structures capturing catalytic intermediates

  • Integrative Structural Biology:

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Small-angle X-ray scattering for solution conformations

    • Molecular dynamics simulations in membrane environments

    • Cross-linking mass spectrometry for interfacial contacts

These approaches have revealed critical structural features of Phosphoglycerol transferase I, including:

  • The presence of a conserved catalytic domain with a characteristic fold

  • A hydrophobic groove accommodating the phosphatidylglycerol substrate

  • A separate binding site for membrane-derived oligosaccharides

  • Conformational changes associated with catalysis

The structural insights gained through these methods are facilitating the development of refined mechanistic models for Phosphoglycerol transferase I catalysis, enhancing our understanding of this crucial enzyme in bacterial membrane biology.

What emerging techniques are advancing mdoB research beyond traditional approaches?

The field of mdoB research is experiencing rapid evolution through the application of cutting-edge technologies that extend beyond conventional biochemical and genetic approaches. These emerging techniques are providing novel insights into Phosphoglycerol transferase I function and regulation.

Innovative Methodological Approaches:

  • CRISPR-Cas9 Genome Editing:

    • Precise mdoB modifications in diverse E. coli strains

    • Creation of conditional knockdowns with inducible interference

    • Multiplexed editing of mdoB and interacting genes

    • Base editing for single amino acid substitutions without double-strand breaks

  • Advanced Imaging Techniques:

    • Super-resolution microscopy revealing subcellular localization

    • Single-molecule tracking of fluorescently labeled mdoB

    • Correlative light and electron microscopy for contextualized visualization

    • FRET-based sensors for real-time activity monitoring

  • Systems Biology Integration:

    • Multi-omics profiling of mdoB mutants (transcriptomics, proteomics, metabolomics)

    • Network analysis of mdoB interactions in membrane homeostasis

    • Flux balance analysis of membrane lipid metabolism

    • Machine learning identification of mdoB functional patterns

  • Synthetic Biology Applications:

    • Engineered mdoB variants with altered substrate specificities

    • Biosensor development using mdoB regulatory elements

    • Cell-free expression systems for rapid protein engineering

    • Minimal cell approaches to define essential mdoB interactions

Implementation Strategy Table:

TechniqueApplication to mdoB ResearchMethodological AdvantageKey Findings
CRISPRiTunable repression of mdoBAllows titration of expression levelsIdentified minimum threshold for function
PALM/STORM MicroscopyNanoscale localization10-20 nm resolution of membrane proteinsRevealed non-uniform distribution in membrane
Proximity LabelingIdentification of interaction partnersIn situ labeling in native membraneDiscovered novel regulatory proteins
Microfluidic EvolutionDirected evolution of mdoBHigh-throughput functional screeningGenerated variants with enhanced activity

These emerging techniques are transforming our understanding of Phosphoglycerol transferase I by providing more precise, dynamic, and systems-level insights that complement and extend traditional biochemical characterizations.

How does mdoB contribute to antimicrobial resistance mechanisms in pathogenic E. coli?

The relationship between Phosphoglycerol transferase I (mdoB) and antimicrobial resistance represents an evolving area of research with significant clinical implications. While mdoB is not a classical resistance determinant like beta-lactamases or efflux pumps, its role in membrane modification indirectly affects bacterial susceptibility to various antimicrobial agents.

Methodological Approaches to Study mdoB-Mediated Resistance:

  • Minimum Inhibitory Concentration (MIC) Determination:

    • Compare wild-type, mdoB mutant, and complemented strains

    • Test panels of antimicrobials with different mechanisms

    • Determine fold-changes in susceptibility across multiple conditions

    • Perform time-kill kinetics to assess population dynamics

  • Membrane Permeability Assessments:

    • Fluorescent dye uptake assays (propidium iodide, NPN)

    • Liposome model systems with reconstituted components

    • Atomic force microscopy of membrane physical properties

    • Electrophysiological measurements of membrane potential

  • Molecular Mechanism Investigation:

    • Surface charge measurements via zeta potential

    • Lipid A and MDO modification profiling

    • Gene expression analysis under antimicrobial stress

    • Competitive fitness assays in presence of antimicrobials

Research Findings on mdoB and Resistance:

Antimicrobial ClassImpact of mdoB MutationProposed MechanismMethodological Evidence
Cationic Antimicrobial PeptidesIncreased susceptibilityAltered surface charge due to missing phosphoglycerol residuesZeta potential measurements, MIC determination
AminoglycosidesModerate susceptibility increaseModified uptake across membraneGentamicin accumulation assays, time-kill curves
Beta-lactamsStrain-dependent effectsChanges in peptidoglycan-MDO interactionsCell wall integrity assays, peptidoglycan analysis
PolymyxinsSignificant susceptibility increaseDisrupted outer membrane organizationMembrane permeability assays, lipid A analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.