Recombinant Escherichia coli O7:K1 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
kdpC; ECIAI39_0655; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
kdpC
Target Protein Sequence
MSGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDASTSVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVNYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of the kdpC subunit in the KdpFABC complex of E. coli O7:K1?

The kdpC subunit serves as an essential component of the KdpFABC complex, which functions as a high-affinity K⁺ uptake system in E. coli, including the O7:K1 strain. This complex is responsible for maintaining potassium homeostasis under conditions of potassium limitation. Structurally, kdpC is a peripheral membrane protein that interacts closely with the catalytic KdpB subunit (a P-type ATPase) and contributes to the stability of the entire complex . The KdpFABC complex utilizes ATP hydrolysis to accomplish K⁺ transport, with the energy from ATP hydrolysis being coupled to potassium movement across the membrane .

For researchers studying this component, it's important to understand that kdpC doesn't function independently but works in concert with the other subunits to facilitate potassium transport. Experimental designs should account for these interactions when investigating kdpC specifically.

How does the kdpC component in E. coli O7:K1 differ from other E. coli strains?

When examining E. coli O7:K1 strains, particularly those isolated from cerebrospinal fluid (CSF) in meningitis cases, researchers should note that genomic comparisons have revealed that E. coli K1 strains can be categorized into two distinct groups based on their virulence factors, lipoproteins, proteases, and outer membrane proteins . While the search results don't specifically detail kdpC variations between these groups, this subgrouping suggests potential functional differences in membrane proteins like kdpC between strains.

The O7 antigen in E. coli K1 strain VW187 is determined by chromosomal rfb genes, and these genes appear to be unique, as they don't hybridize with genomic DNA from E. coli strains of different O types . Such genetic uniqueness may extend to other membrane-associated systems, potentially including the kdp operon that encodes the potassium transport complex.

What are the recommended protocols for cloning and expressing recombinant kdpC from E. coli O7:K1?

Based on successful approaches with related E. coli components, the following methodological framework is recommended:

  • Gene Isolation: PCR amplification of the kdpC gene from E. coli O7:K1 genomic DNA using primers designed from conserved regions of the gene.

  • Vector Selection: Use of expression vectors containing strong, inducible promoters (e.g., pET series) for high-level expression in E. coli K-12 strains.

  • Transformation Strategy: When introducing recombinant kdpC into E. coli K-12, consider that previous work with O7 LPS genes showed significantly lower expression levels in K-12 compared to wild-type strains . This suggests potential regulatory differences that might affect kdpC expression as well.

  • Expression Optimization: Conduct small-scale expression trials varying temperature (18-37°C), inducer concentration, and duration to determine optimal conditions.

  • Verification Methods: Confirm successful expression through Western blotting with kdpC-specific antibodies and functional assays measuring ATPase activity.

The cloning strategy should be designed with consideration to the complete kdp operon structure, as isolated expression of kdpC without its partner proteins may result in instability or improper folding.

What experimental design considerations are crucial when studying the structure-function relationship of kdpC in E. coli O7:K1?

When designing experiments to investigate the structure-function relationship of kdpC, researchers should employ the fundamental principles of experimental design:

  • Replication: Design experiments with sufficient biological replicates (minimum n=3) to account for natural variation in protein expression and function .

  • Randomization: Randomize sample processing to minimize systematic errors in structural or functional assays .

  • Blocking: Use appropriate blocking in experimental designs, particularly when comparing wild-type and mutant constructs, to control for factors like batch effects .

  • Control Selection: Include both positive controls (known functional kdpC) and negative controls (kdpC-deletion mutants) to validate assay performance.

Experimental ApproachTechnical ConsiderationsExpected Outcomes
Site-directed mutagenesisTarget conserved residues identified through sequence alignmentIdentification of key residues for kdpC function
Truncation analysisDesign constructs that systematically remove domainsDelineation of interaction interfaces with kdpB
Cryo-EM analysisSample preparation at different ATP/ADP statesStructural transitions during transport cycle
Isothermal titration calorimetryPurified kdpC with varying K⁺ concentrationsBinding affinities and thermodynamic parameters

For structure determination approaches like cryo-EM, researchers should prepare samples in multiple intermediate states of the transport cycle, as demonstrated in studies of human Na⁺/K⁺-ATPase, which revealed five distinct conformational states .

How do mutations in kdpC affect the potassium transport mechanism in E. coli O7:K1?

Methodological approach for investigating mutations:

  • Systematic Mutagenesis: Create a library of kdpC mutants targeting predicted functional domains and conserved residues.

  • Functional Complementation: Test mutants for their ability to restore growth of a kdpC knockout strain under potassium limitation.

  • Transport Kinetics: Measure potassium uptake rates using isotope tracing (⁸⁶Rb⁺) or potassium-sensitive fluorescent probes.

  • ATPase Activity Assays: Quantify ATP hydrolysis rates of purified mutant complexes compared to wild-type.

  • Structural Analysis: Employ cryo-EM to visualize conformational states of wild-type and mutant complexes, focusing on intermediate states of the transport cycle .

Researchers should interpret mutation effects in the context of the complete transport cycle, which for P-type ATPases involves distinct conformational states including cytoplasmic side-open (E1), ATP-bound cytoplasmic side-open (E1- ATP), ion-occluded (E1- P-ADP), exoplasmic side-open (E2P), and ion-occluded (E2- Pi) states .

What are the molecular mechanisms underlying the differential expression of kdpC in the two subgroups of E. coli K1 strains?

This advanced question addresses the potential differences in kdpC expression between the two subgroups of E. coli K1 strains identified in meningitis isolates . The methodological approach should include:

  • Comparative Transcriptomics: Perform RNA-Seq analysis of representative strains from both subgroups under potassium-limited conditions to quantify kdpC expression levels.

  • Promoter Analysis: Clone promoter regions of kdp operons from both subgroups into reporter constructs to assess transcriptional activity differences.

  • ChIP-Seq Analysis: Identify differential binding of transcriptional regulators to the kdp operon in both subgroups.

  • Regulatory Network Mapping: Use systems biology approaches to map the regulatory networks governing kdpC expression in both subgroups.

Importantly, the search results indicate that group 2 strains contain genes for type III secretion system apparatus, while group 1 strains predominantly utilize the general secretory pathway . These differences in secretion systems may influence membrane composition and, consequently, affect the regulation and function of membrane-associated systems like KdpFABC.

How does the potassium transport mechanism of recombinant E. coli O7:K1 kdpC compare with the Na⁺/K⁺-ATPase mechanism in human cells?

While both systems transport potassium ions, there are fundamental differences in their structures, stoichiometry, and transport mechanisms:

FeatureE. coli KdpFABCHuman Na⁺/K⁺-ATPase
Subunit compositionFour subunits (KdpF, KdpA, KdpB, KdpC)Three subunits (α, β, FXYD)
Ion stoichiometryHigh-affinity K⁺ uptake3 Na⁺ out, 2 K⁺ in per ATP
Catalytic subunitKdpB (P-type ATPase)α subunit (P-type ATPase)
Transport cycleE1/E2 alternating accessE1/E2 alternating access with 5 distinct states
Regulatory mechanismsTranscriptional regulation via kdpDE two-component systemPost-translational modification, FXYD regulation

Despite these differences, both systems utilize the energy from ATP hydrolysis through P-type ATPase components (KdpB in E. coli and α subunit in humans) . The Na⁺/K⁺-ATPase transport cycle has been characterized in greater detail, with cryo-EM structures available for five distinct conformational states during transport .

For researchers studying kdpC, the structural and functional insights from human Na⁺/K⁺-ATPase studies can provide valuable reference points, particularly regarding the conformational changes during the transport cycle, although direct extrapolation should be done cautiously given the evolutionary distance between these systems.

Why is the expression level of recombinant kdpC from E. coli O7:K1 significantly lower in E. coli K-12 strains?

This troubleshooting question addresses a common issue encountered when expressing components from pathogenic strains in laboratory strains. Based on similar observations with O7 LPS expression, where "the amount of O7 LPS expressed in E. coli K-12 was considerably lower than that produced by the wild-type strain VW187" , researchers might encounter similar challenges with kdpC expression.

Methodological approaches to address low expression:

  • Codon Optimization: Analyze codon usage in the O7:K1 kdpC gene and optimize for E. coli K-12 expression.

  • Co-expression of Chaperones: Include molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding.

  • Expression Temperature Adjustment: Lower induction temperatures (16-25°C) often improve soluble protein yield.

  • Regulatory Element Analysis: Investigate if regulatory elements from the O7:K1 strain are required for efficient expression.

  • Alternative Host Strains: Test BL21(DE3) or other E. coli strains optimized for recombinant protein expression.

The significantly lower expression of O7 components in K-12 strains suggests potential incompatibilities in genetic regulatory systems or differences in cellular physiology that should be considered when designing expression systems for kdpC .

How can researchers address data inconsistencies when comparing in vitro and in vivo studies of kdpC function?

This methodological question addresses the common challenge of reconciling differences between in vitro biochemical studies and in vivo functional analyses:

  • Physiological Context Reconstruction: For in vitro studies, carefully mimic the physiological environment (ion concentrations, pH, membrane composition) of E. coli.

  • Validation Across Multiple Approaches: Employ orthogonal techniques to verify findings:

    • Combine biochemical assays with genetic complementation studies

    • Correlate structural studies with functional measurements

    • Use both purified proteins and membrane preparations

  • Strain Background Consideration: Account for potential differences between laboratory and clinical isolates, particularly given the two distinct groups of E. coli K1 strains identified in meningitis cases .

  • Standardized Reporting: Adopt the "failure is not an option" approach to experimental design advocated in the literature , with careful documentation of all experimental parameters.

When inconsistencies arise, systematically evaluate potential sources of variation including protein purification methods, lipid composition of assay systems, and the presence or absence of other Kdp subunits that might influence kdpC behavior.

How might cryo-EM structural studies advance our understanding of kdpC in the potassium transport mechanism?

Cryo-electron microscopy (cryo-EM) represents a powerful approach for elucidating the structural basis of ion transport mechanisms, as demonstrated by studies of the human Na⁺/K⁺-ATPase . For kdpC research, cryo-EM offers several methodological advantages:

  • Visualization of Transport Cycle Intermediates: By preparing samples under different conditions (ATP, ADP, vanadate, etc.), researchers can capture distinct conformational states of the KdpFABC complex, similar to the five states identified for Na⁺/K⁺-ATPase (E1, E1- ATP, E1- P-ADP, E2P, and E2- Pi) .

  • Structural Basis for Subunit Interactions: High-resolution structures can reveal the specific interactions between kdpC and other subunits, particularly the catalytic kdpB subunit, providing insights into how kdpC contributes to complex stability and function.

  • Ion Binding Site Identification: Structures can potentially identify potassium binding sites and elucidate how conformational changes in kdpC might influence ion coordination during transport.

  • Rational Design of Functional Studies: Structural insights can guide the design of targeted mutagenesis experiments to test specific hypotheses about kdpC function.

Future cryo-EM studies might focus on visualizing the transport cycle of the KdpFABC complex from E. coli O7:K1, potentially revealing strain-specific structural features that contribute to the virulence of this pathogenic strain.

What genomic approaches can be used to explore the evolutionary relationship between kdpC variants in different E. coli strains?

This advanced research question addresses the genetic diversity and evolutionary history of kdpC across E. coli strains, with particular focus on the O7:K1 serotype associated with meningitis:

  • Comparative Genomics Pipeline:

    • Extract kdpC sequences from whole-genome data of diverse E. coli strains

    • Perform multiple sequence alignment to identify conserved and variable regions

    • Construct phylogenetic trees to infer evolutionary relationships

    • Identify selective pressures using dN/dS ratio analysis

  • Population Genetics Approach:

    • Analyze kdpC sequences from clinical isolates representing different pathotypes

    • Compare meningitis-associated O7:K1 strains with other K1 strains

    • Investigate horizontal gene transfer events that might have influenced kdpC evolution

  • Structure-Function Correlation:

    • Map sequence variations onto structural models to identify functionally significant polymorphisms

    • Test the functional impact of natural variants through complementation studies

When conducting these analyses, researchers should consider the finding that E. coli K1 strains isolated from CSF can be divided into two distinct groups , which may represent different evolutionary lineages with potentially different kdpC variants. Additionally, the observation that O7 LPS genes are unique and do not hybridize with genes from other O types suggests potential serotype-specific genetic contexts that might influence kdpC evolution.

What controls are essential when designing experiments to study the function of recombinant E. coli O7:K1 kdpC?

This methodological question addresses the critical role of proper controls in experimental design, following the principle that "failure is not an option" in biological research :

  • Genetic Controls:

    • Positive control: Wild-type kdpC from E. coli O7:K1

    • Negative control: kdpC deletion mutant

    • Complementation control: kdpC knockout strain complemented with wild-type kdpC

    • Strain background control: Compare results in different E. coli strains

  • Biochemical Controls:

    • Substrate specificity: Test ATPase activity with different nucleotides (GTP, CTP)

    • Ion specificity: Measure transport with various monovalent cations (Na⁺, Rb⁺, Cs⁺)

    • Inhibitor controls: Use specific P-type ATPase inhibitors

    • Protein purity controls: Include size-exclusion chromatography analysis

  • Environmental Controls:

    • Potassium concentration: Test function under varying K⁺ levels

    • pH dependency: Examine activity across physiological pH range

    • Temperature sensitivity: Assess function at different temperatures

These controls align with the four basic tenets of experimental design: replication, randomization, blocking, and appropriate sizing of experimental units . By implementing comprehensive controls, researchers can increase confidence in their findings and facilitate the interpretation of complex data regarding kdpC function.

How should researchers design experiments to investigate the potential role of kdpC in the virulence of E. coli O7:K1?

This advanced question bridges basic research on potassium transport with the clinical relevance of E. coli O7:K1 in meningitis:

  • Genetic Approach:

    • Create precise kdpC deletion mutants in E. coli O7:K1 clinical isolates

    • Perform complementation with wild-type and mutant kdpC variants

    • Use CRISPR interference for conditional knockdown of kdpC expression

  • In Vitro Infection Models:

    • Compare wild-type and kdpC mutant strains in human brain microvascular endothelial cell invasion assays

    • Assess intracellular survival in macrophages under varying potassium conditions

    • Measure biofilm formation capacity on relevant surfaces

  • Transcriptomic Analysis:

    • Compare gene expression profiles of wild-type and kdpC mutants under infection-relevant conditions

    • Identify virulence factors co-regulated with kdpC expression

    • Investigate stress responses related to potassium homeostasis during infection

Researchers should consider the finding that E. coli K1 strains can be divided into two groups potentially using different virulence mechanisms . The experimental design should include representative strains from both groups to account for potential differences in how kdpC contributes to virulence in these distinct lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.