Recombinant Escherichia coli O7:K1 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant ArnF is a 128-amino acid protein (UniProt ID: B7NNT8) expressed in Escherichia coli with an N-terminal His-tag . It belongs to the undecaprenyl phosphate-aminoarabinose (UPP-Ara4N) flippase complex, which translocates lipid-linked L-Ara4N across the inner membrane to modify lipid A—a critical step in polymyxin resistance .

Functional Role in Lipid A Modification

ArnF operates as part of the ArnEF flippase complex to transport UPP-Ara4N from the cytoplasmic to periplasmic leaflet of the inner membrane . This enables ArnT to transfer L-Ara4N to lipid A, neutralizing the negative charge of lipid A and reducing polymyxin binding .

Key Findings from Mutational Studies

  • arnF Knockout: Abolishes polymyxin resistance in E. coli pmrA(c) strains, despite normal UPP-Ara4N biosynthesis .

  • Substrate Localization: arnF mutants retain UPP-Ara4N but show 4–5× reduced periplasmic exposure, confirmed by biotinylation assays .

Research Applications

Recombinant ArnF is utilized for:

  1. Mechanistic Studies: Investigating flippase dynamics via crosslinking or fluorescence assays.

  2. Antibiotic Resistance Screening: Identifying inhibitors targeting L-Ara4N-dependent lipid A modification.

  3. Structural Biology: Serving as a template for homology modeling of flippases in pathogenic bacteria .

Expression and Purification Protocols

StepConditions
Expression VectorpET-based plasmid in E. coli BL21(DE3)
Induction0.5 mM IPTG at 18°C for 16–20 hours
SolubilizationDetergent (e.g., DDM) for membrane extraction
ChromatographyNi-NTA affinity + size-exclusion polishing

Limitations and Considerations

  • Instability: Repeated freeze-thaw cycles degrade activity; aliquot storage recommended .

  • Species Variants: Salmonella typhi ArnF (Q8Z537) shares 78% sequence identity but differs in substrate specificity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnF; ECIAI39_2406; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
arnF
Target Protein Sequence
MGLMWGLFSVIIASAAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLQGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are typically used for recombinant arnF production?

Recombinant arnF protein is commonly expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The full-length protein (amino acids 1-128) can be successfully expressed in E. coli and purified using affinity chromatography techniques .

The expression construct typically includes:

  • Full-length coding sequence (1-128 amino acids)

  • N-terminal His-tag for purification

  • Appropriate promoter systems for controlled expression

The protein is often supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis .

How does arnF interact with other components of the L-Ara4N-phosphoundecaprenol flippase complex?

The arnF protein functions as a subunit within the larger L-Ara4N-phosphoundecaprenol flippase complex. This multicomponent system facilitates the translocation of aminoarabinose-modified lipids across bacterial membranes. Research questions in this area should address:

  • Protein-protein interaction studies between arnF and other flippase components

  • Structural analysis of the complete flippase complex

  • Functional domains within arnF responsible for subunit assembly

Methodologically, researchers should consider co-immunoprecipitation studies with other components of the flippase complex, followed by mass spectrometry analysis to identify interaction partners. Cross-linking studies combined with structural analyses would help elucidate the spatial arrangement of arnF within the complex.

What role might arnF play in antimicrobial resistance mechanisms in E. coli O7:K1?

The modification of bacterial cell surfaces with 4-amino-4-deoxy-L-arabinose (L-Ara4N) is a documented mechanism for resistance to cationic antimicrobial peptides and certain antibiotics. As a component of the flippase responsible for L-Ara4N translocation, arnF may contribute significantly to antimicrobial resistance.

Research approaches should investigate:

  • Comparative resistance profiles between wild-type and arnF-deficient strains

  • Changes in membrane permeability upon arnF overexpression or deletion

  • Synergistic effects between arnF-mediated modifications and other resistance mechanisms

A comprehensive experimental design would include minimum inhibitory concentration (MIC) determinations for various antimicrobials against isogenic strains with variable arnF expression, combined with membrane integrity assays and surface charge analysis techniques.

How does the function of arnF in E. coli O7:K1 compare with homologous proteins in other pathogenic bacteria?

Comparative genomic and functional analyses of arnF homologs across different bacterial species would provide insights into evolutionary conservation and functional divergence. This could reveal whether the role of arnF in E. coli O7:K1 represents a conserved virulence mechanism or a species-specific adaptation.

Research in this area should employ:

  • Sequence alignment and phylogenetic analysis of arnF homologs

  • Complementation studies with heterologous expression

  • Structural modeling to identify conserved functional domains

What are the optimal conditions for recombinant arnF protein purification and storage?

The recombinant arnF protein requires specific handling conditions to maintain stability and functionality. Based on available information, the recommended protocols include:

Purification Process:

  • Express the His-tagged protein in E. coli expression systems

  • Lyse cells under conditions that preserve membrane protein integrity

  • Purify using affinity chromatography (Ni-NTA or similar)

  • Verify purity via SDS-PAGE (>90% purity standard)

Storage Recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

What experimental approaches are suitable for studying arnF-mediated membrane transport?

Investigating the flippase activity of arnF requires specialized techniques for membrane transport analysis. Recommended methodological approaches include:

  • Liposome Reconstitution Assays:

    • Purify recombinant arnF and reconstitute in artificial liposomes

    • Incorporate fluorescent or radioactively labeled L-Ara4N derivatives

    • Monitor transport across the membrane barrier

  • Protein-Lipid Interaction Studies:

    • Employ surface plasmon resonance (SPR) to quantify binding affinities

    • Use fluorescence resonance energy transfer (FRET) to analyze real-time interactions

    • Investigate substrate specificity through competitive binding assays

  • Genetic Complementation:

    • Generate arnF knockout strains

    • Perform complementation with wild-type or mutant variants

    • Assess phenotypic restoration of transport function

How can researchers effectively generate and validate arnF knockout strains?

The generation of arnF knockout strains is essential for functional characterization. Based on methodologies used for similar genes in E. coli, the following approach is recommended:

  • Gene Deletion Strategy:

    • Use λ-Red recombination system for targeted gene replacement

    • Design chimeric PCR primers with homologous arms flanking the arnF gene

    • Generate a DNA fragment containing antibiotic resistance cassette and homologous regions

    • Transform into target E. coli strain for homologous recombination

    • Remove the resistance cassette using flippase (FLP) recombination if needed

  • Validation Methods:

    • Confirm deletion by colony PCR and DNA sequencing

    • Verify expression loss by RT-PCR and Western blotting

    • Assess growth curves to ensure no significant growth defects

    • Examine membrane integrity using detergent sensitivity tests (e.g., Triton X-100 exposure)

    • Evaluate phenotypic changes related to expected arnF function

How might arnF function contribute to the development of novel antimicrobial strategies?

Understanding arnF's role in membrane modification presents opportunities for targeting this system in antimicrobial development. Research directions could include:

  • Structure-Based Inhibitor Design:

    • Determine high-resolution structure of arnF through crystallography or cryo-EM

    • Identify druggable binding pockets

    • Design small molecule inhibitors that disrupt flippase activity

  • Combination Therapy Approaches:

    • Identify synergistic effects between arnF inhibition and existing antibiotics

    • Develop dual-targeting strategies that simultaneously compromise multiple bacterial defense mechanisms

  • Immunomodulatory Strategies:

    • Investigate how arnF-mediated membrane modifications affect host immune recognition

    • Develop adjuvants that enhance immune detection of modified bacterial surfaces

What analytical methods are most effective for characterizing arnF-mediated membrane modifications?

The study of membrane modifications facilitated by arnF requires specialized analytical techniques:

  • Mass Spectrometry Analysis:

    • Liquid chromatography-mass spectrometry (LC-MS) to profile LPS modifications

    • Matrix-assisted laser desorption/ionization (MALDI) for intact membrane analysis

    • Tandem mass spectrometry for structural characterization of modified lipids

  • Biophysical Membrane Characterization:

    • Differential scanning calorimetry to assess membrane fluidity changes

    • Atomic force microscopy for nanoscale membrane structure visualization

    • Neutron reflectometry to determine molecular organization at membrane interfaces

  • Functional Permeability Assays:

    • Fluorescent dye uptake/leakage studies

    • Antibiotic penetration assays

    • Membrane potential measurements using voltage-sensitive probes

How can researchers address the challenges of working with membrane proteins like arnF?

Membrane proteins present unique challenges for research. Recommended strategies include:

  • Expression Optimization:

    • Test multiple expression systems (bacterial, yeast, insect, mammalian)

    • Evaluate expression temperature, induction conditions, and media formulations

    • Consider fusion partners to enhance solubility and stability

  • Purification Strategies:

    • Select appropriate detergents for membrane protein extraction

    • Optimize buffer conditions to maintain native conformation

    • Consider amphipol or nanodisc technologies for detergent-free systems

  • Functional Reconstitution:

    • Develop proteoliposome systems that mimic native membrane environments

    • Verify proper protein orientation in reconstituted systems

    • Include essential lipid components required for function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.