Recombinant Escherichia coli O7:K1 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Biological Role in E. coli

YciB works synergistically with DcrB, another inner membrane protein, to maintain cell envelope integrity. Key findings from functional studies include:

Functional AspectResearch Insight
Membrane StabilityDeletion of yciB and dcrB causes cytoplasmic membrane shrinkage, vesiculation, and cell lysis .
Lipopolysaccharide (LPS)Mutants show increased LPS levels, suggesting disrupted outer membrane homeostasis .
Peptidoglycan LinkagesStalled outer membrane lipoprotein Lpp forms lethal linkages with peptidoglycan in mutants .
Stress ResponseActivates the Cpx envelope stress response pathway to compensate for membrane damage .

These roles highlight YciB’s critical function in coordinating inner and outer membrane biogenesis .

Recombinant Production and Challenges

Recombinant YciB is typically expressed in E. coli BL21(DE3) or K-12 derivatives. Key considerations include:

  • Expression Strains: BL21(DE3) lacks Lon and OmpT proteases, reducing protein degradation .

  • Secretion: Requires Sec-dependent or SRP pathways for periplasmic localization, often using signal peptides like OmpA or PelB .

  • Disulfide Bonds: Engineered strains like SHuffle® T7 Express (with cytoplasmic DsbC) improve folding for proteins requiring disulfide bonds .

Challenges include low yield when expressing membrane proteins and the need for codon optimization in non-K-12 strains .

Research Applications

  • Mechanistic Studies: Used to investigate YciB-DcrB interactions and their role in cell division .

  • Envelope Stress Models: Serves as a tool to study Cpx and σ<sup>E</sup> stress response activation .

  • Antibiotic Development: Potential target for disrupting membrane integrity in pathogenic E. coli .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; ECIAI39_1591; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YciB in Escherichia coli?

YciB is an inner membrane protein in Escherichia coli that contains five transmembrane domains. It plays roles in cell division and elongation processes. The protein's membrane topology has been clarified through experimental analysis, confirming the presence of the five transmembrane domains that were previously only predicted. YciB is involved in synthesis of the cell envelope through interactions with cell elongation and division complexes, making it important for maintaining proper bacterial cell morphology and division processes .

How does YciB affect E. coli cell morphology?

YciB significantly influences E. coli cell morphology through multiple mechanisms. Deletion mutants of yciB (ΔyciB) exhibit shorter cell lengths compared to wild-type bacteria. Conversely, overexpression of yciB causes cell elongation. These phenotypic changes indicate YciB's crucial role in regulating cell length. Additionally, the protein appears to affect septal morphology, as the septum localization of ZipA (an essential cell division protein) is disturbed in ΔyciB mutants. These observations collectively suggest that YciB contributes to proper cell envelope synthesis and maintenance of the rod-shaped morphology characteristic of E. coli .

What experimental systems are used to study YciB function?

Several experimental systems have been employed to elucidate YciB function. Membrane topology has been studied using the dual pho-lac reporter system, which determines whether protein segments are located in the cytoplasm or periplasm. Bacterial two-hybrid systems have been utilized to identify proteins that interact with YciB, revealing connections to cell elongation and division proteins. Additionally, gene deletion studies (ΔyciB mutants) and overexpression experiments have provided insights into YciB's role in cellular processes. Osmolarity susceptibility tests have also been conducted, showing that ΔyciB mutants are more susceptible to low osmolarity environments, further indicating YciB's involvement in maintaining cell envelope integrity .

What is known about YciB's protein interactions?

YciB has been found to interact with various proteins involved in cell elongation and cell division processes. Most notably, it directly interacts with ZipA, an essential protein required for cell division. This interaction has been confirmed through purification studies of the YciB protein. The bacterial two-hybrid system has been particularly useful in identifying multiple other protein interactions. These interaction studies suggest that YciB participates in cell envelope synthesis in a manner that is directed by ZipA but independent of PBP3 (a penicillin-binding protein involved in septum formation). These protein-protein interactions are critical to understanding YciB's role in the molecular machinery of bacterial cell division .

How does the O7-lipopolysaccharide influence recombinant YciB expression?

The expression of recombinant proteins in E. coli, including YciB, can be significantly affected by the host strain's lipopolysaccharide (LPS) composition. When expressing recombinant YciB in E. coli K-12 strains, researchers should consider the impact of the O7-LPS antigen. Studies on O7-LPS gene expression have shown that the amount of O7 LPS expressed in E. coli K-12 strains is considerably lower than that produced by wild-type strains like VW187. This reduced expression could potentially affect membrane protein integration and function. Approximately 17 kilobase pairs of genetic material are essential for the expression of O7 LPS, encoding at least 16 polypeptides with molecular masses ranging from 20 to 48 kilodaltons. When designing expression systems for YciB, researchers should consider these factors to optimize protein production and ensure proper membrane integration .

What methodological approaches resolve contradictions in YciB functional studies?

Resolving contradictions in YciB functional studies requires a multi-faceted methodological approach. First, comprehensive genetic analysis through complementation studies can clarify conflicting phenotypes. This involves reintroducing wild-type yciB into deletion mutants to confirm that observed phenotypes are directly attributable to YciB. Second, employing transposon mutagenesis with reporter systems (such as Tn3HoHo1 with promoterless lac operons) can generate transcriptional fusions that reveal expression patterns and regulatory mechanisms. Third, utilizing in vitro transcription-translation experiments alongside in vivo studies helps reconcile differences between biochemical and cellular observations. Finally, integrating multiple analytical techniques—including silver staining, immunoblotting, and coagglutination reactions—provides a more complete picture of YciB's role in processes like cell division and envelope synthesis. When contradictions arise, researchers should systematically examine differences in strain backgrounds, growth conditions, and experimental methodologies that might account for discrepancies .

How does YciB contribute to the ZipA-mediated cell division pathway?

YciB contributes to the ZipA-mediated cell division pathway through specific molecular mechanisms that are PBP3-independent. Direct interaction between purified YciB and ZipA has been experimentally confirmed, providing strong evidence for YciB's role in this pathway. ZipA, an essential cell division protein that anchors FtsZ rings to the cytoplasmic membrane, shows disturbed septum localization in ΔyciB mutants. This mislocalization suggests that YciB may help position or stabilize ZipA at the division site. The phenotypic consequences of yciB deletion (shorter cells) and overexpression (elongated cells) further support YciB's involvement in regulating cell length through division mechanisms. YciB likely functions in cell envelope synthesis directed by ZipA, potentially serving as a bridge between the division machinery and cell wall synthesis apparatus. This relationship appears to operate independently of PBP3, which is typically involved in septal peptidoglycan synthesis, suggesting that YciB may participate in an alternative or parallel pathway for envelope synthesis during division .

What are the implications of YciB's membrane topology for its function?

The membrane topology of YciB, featuring five transmembrane domains, has significant implications for its functional capabilities. This topology positions specific domains in either the cytoplasm or periplasm, creating a structural framework that facilitates interactions with both cytoplasmic division proteins and periplasmic cell wall synthesis machinery. The experimentally verified membrane arrangement enables YciB to potentially serve as a signal transducer across the inner membrane, coordinating cytoplasmic division events with periplasmic cell envelope synthesis. The topology likely determines which protein domains are available for interaction with partners like ZipA, thereby influencing cell division processes. Additionally, the multi-pass membrane structure suggests YciB might form part of a membrane complex that regulates envelope synthesis in response to cellular cues. Understanding this topology is essential for developing models of how YciB contributes to cell division and for designing experiments to probe domain-specific functions .

What techniques are effective for studying YciB membrane topology?

Several techniques have proven effective for studying YciB membrane topology. The dual pho-lac reporter system has been particularly valuable, as it allows researchers to determine whether specific portions of the protein reside in the cytoplasm or periplasm. In this system, the color on indicator plates of E. coli strain DH5α (phoA-lacZ-ΔM15) carrying the pKTop plasmid reveals the localization of the C-terminus of the expressed protein. This approach has confirmed the presence of five transmembrane domains in YciB. Additionally, fusion protein analysis with reporter tags at various positions along the protein sequence can provide detailed mapping of membrane-spanning segments. Computational prediction tools can offer initial topology models, but experimental verification through these methods is essential for accurate characterization. When determining YciB's membrane orientation, researchers should design multiple fusion constructs targeting different regions of the protein to develop a comprehensive topological map .

How can researchers effectively generate and characterize YciB mutants?

Effective generation and characterization of YciB mutants requires a systematic approach. First, precise gene deletion mutants (ΔyciB) can be created using lambda Red recombination or CRISPR-Cas9 techniques, ensuring clean deletions without polar effects on adjacent genes. Site-directed mutagenesis should target conserved residues or domains identified through sequence alignment across bacterial species to generate point mutations for structure-function analysis. For phenotypic characterization, researchers should analyze cell morphology through phase-contrast microscopy and electron microscopy, measuring parameters like cell length, width, and division site placement. Osmolarity susceptibility tests are crucial, as ΔyciB mutants show increased sensitivity to low osmolarity environments. Protein-protein interaction studies using bacterial two-hybrid systems or co-immunoprecipitation can reveal how specific mutations affect YciB's ability to interact with partners like ZipA. Additionally, complementation studies with wild-type yciB should be performed to confirm that observed phenotypes are directly attributable to the mutation. For comprehensive characterization, growth curves, biofilm formation assays, and cell envelope integrity tests should be conducted under various environmental conditions .

What expression systems are optimal for recombinant YciB production?

Optimizing recombinant YciB production requires careful consideration of expression systems due to its nature as a membrane protein. The most effective approach involves using E. coli BL21(DE3) strains with the pET expression system under the control of the T7 promoter, which provides tight regulation and high expression levels. For membrane proteins like YciB, lower induction temperatures (16-20°C) slow protein synthesis, allowing proper membrane insertion and reducing the formation of inclusion bodies. Expression vectors should include fusion tags (such as His6, MBP, or SUMO) at either the N- or C-terminus to facilitate purification while maintaining protein function. C-terminal tagging is often preferred for YciB since the N-terminus may contain signal sequences important for membrane targeting. The addition of 0.2-0.5% glucose to the growth medium helps suppress basal expression, while inducer concentrations (typically IPTG) should be optimized at lower levels (0.1-0.5 mM) to prevent overwhelming the membrane insertion machinery. For maximum protein stability, the lysis buffer should contain appropriate detergents (such as n-dodecyl-β-D-maltoside or CHAPS) to solubilize membrane proteins without denaturation. When purifying YciB for functional studies, it's essential to validate proper folding through circular dichroism spectroscopy or limited proteolysis assays .

How can bioinformatic tools guide YciB functional annotation?

Bioinformatic tools provide valuable guidance for YciB functional annotation through multiple complementary approaches. Sequence homology searches using BLAST against diverse bacterial genomes can identify conserved domains and evolutionary relationships that suggest functional roles. INTERPROSCAN and PFAM analyses reveal protein family memberships and conserved motifs, offering insights into potential biochemical activities. Transmembrane domain prediction tools (TMHMM, Phobius) confirm structural features essential to understanding YciB's membrane integration. Protein-protein interaction prediction algorithms can suggest potential binding partners for experimental validation. For comprehensive annotation, researchers should employ multiple tools and verify accuracy through receiver operating characteristic (ROC) curve analysis, similar to approaches used for the reannotation of hypothetical proteins in organisms like Mycoplasma synoviae. This multi-tool approach has proven successful in improving functional annotation rates from 76% to 95% in some bacterial systems. Integration of these computational predictions with experimental data from RNA-Seq and proteomics studies provides the most robust functional annotations. When conflicting predictions arise, researchers should prioritize results from tools with higher specificity for membrane proteins and validate findings through targeted experimental approaches .

What statistical approaches best analyze YciB phenotypic data?

Statistical analysis of YciB phenotypic data requires specialized approaches that account for the unique characteristics of bacterial cellular measurements. For analyzing cell length differences between wild-type and ΔyciB mutants, non-parametric tests such as the Mann-Whitney U test are preferable to t-tests, as cell size distributions often deviate from normality. When examining multiple conditions (e.g., wild-type, deletion mutant, and overexpression strains), one-way ANOVA followed by appropriate post-hoc tests (Tukey's HSD or Dunnett's test) should be employed. For time-course experiments measuring dynamic processes like cell division or envelope synthesis, repeated measures ANOVA or mixed-effects models provide more robust analysis. Statistical power calculations should aim for sample sizes of at least 100-200 cells per condition to account for natural cell-to-cell variability. When analyzing the co-localization of YciB with other proteins (such as ZipA), Pearson's or Mander's correlation coefficients offer quantitative measures of spatial relationships. For all analyses, researchers should report effect sizes alongside p-values to convey biological significance beyond statistical significance. Data visualization through box plots or violin plots rather than simple bar graphs better represents the distribution of cellular measurements and highlights population heterogeneity .

How do researchers interpret contradictory findings in YciB interaction studies?

Interpreting contradictory findings in YciB interaction studies requires careful consideration of methodological differences and biological contexts. First, researchers should evaluate the detection methods used—bacterial two-hybrid systems may identify indirect interactions that direct pull-down assays might miss, leading to apparent contradictions. Second, interaction conditions matter significantly; binding affinities between YciB and partners like ZipA may vary dramatically under different pH, salt concentration, or membrane composition conditions. Third, the specific protein constructs used (full-length versus truncated versions) can greatly influence interaction results, as transmembrane domains often contribute to binding stability. Fourth, contradictions may reflect genuine biological complexity rather than experimental error—YciB might interact with different partners at different cell cycle stages or under specific stress conditions. When faced with contradictory findings, researchers should systematically test interactions across multiple methodological platforms (two-hybrid, co-immunoprecipitation, FRET, etc.) and experimental conditions. Additionally, in vivo validation through techniques like fluorescence microscopy co-localization studies can help resolve which interactions occur in the native cellular environment. Creating a detailed interaction map that specifies the conditions under which each interaction occurs provides the most comprehensive understanding of YciB's functional networks .

What is the relationship between YciB expression levels and cell morphology parameters?

The relationship between YciB expression levels and cell morphology parameters follows a non-linear pattern that reflects YciB's role in cell division and elongation processes. Based on experimental evidence, there exists a clear correlation between YciB levels and several key morphological parameters as summarized in the table below:

YciB Expression LevelCell LengthSeptum FormationZipA LocalizationOsmotic Resistance
Deletion (ΔyciB)DecreasedAlteredDisturbedReduced
Wild-typeNormalNormalNormalNormal
OverexpressionIncreasedDelayedNot reportedNot reported

This dosage-dependent relationship suggests that YciB functions as a modulator rather than an on/off switch in cellular processes. The shorter cell phenotype in deletion mutants indicates that YciB is required for proper cell elongation, while the elongated phenotype upon overexpression suggests that excess YciB may interfere with normal septation or cell division timing. The disturbed ZipA localization in ΔyciB mutants further supports YciB's role in organizing division machinery at the septum. The precise molecular mechanisms underlying these morphological effects likely involve YciB's interactions with cell elongation and division proteins, potentially through a ZipA-dependent but PBP3-independent pathway. For accurate interpretation of these relationships, researchers should employ quantitative imaging techniques and measure multiple morphological parameters simultaneously across a gradient of expression levels .

How can researchers overcome challenges in YciB purification for functional studies?

Purifying YciB for functional studies presents several challenges due to its nature as a multi-pass membrane protein. Researchers can implement specific strategies to overcome these obstacles. First, using specialized expression vectors with fusion tags that enhance solubility (such as MBP or SUMO) significantly improves purification yields. The detergent selection is critical—mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration effectively solubilize YciB while maintaining native conformation. Incorporating a two-step purification protocol using affinity chromatography followed by size exclusion chromatography removes contaminants and aggregates. During expression, lowering the temperature to 16-20°C and reducing inducer concentration to 0.1-0.2 mM IPTG facilitates proper membrane insertion and reduces inclusion body formation. For maintaining protein stability during purification, adding glycerol (10-15%) and specific lipids (E. coli polar lipid extract at 0.1-0.2 mg/ml) to all buffers helps preserve native-like membrane environments. Additionally, utilizing amphipols or nanodiscs for the final purified protein provides a more native-like environment than detergent micelles for functional studies. Researchers should verify protein integrity through circular dichroism spectroscopy and thermal shift assays before proceeding to interaction or functional studies .

What controls are essential when studying YciB's role in cell division?

Essential controls for studying YciB's role in cell division ensure experimental validity and help distinguish direct from indirect effects. First, complementation controls are critical—phenotypes observed in ΔyciB mutants should be restored by expressing wild-type YciB from a plasmid, preferably under native promoter control. Second, researchers should include domain-specific mutants (targeting each transmembrane domain separately) to identify which regions are essential for division functions. Third, when studying YciB-ZipA interactions, parallel experiments with other division proteins (FtsA, FtsZ) serve as specificity controls to determine whether observed effects are ZipA-specific or affect the entire division apparatus. Fourth, growth condition controls are vital—experiments should be performed at various temperatures (30°C, 37°C, 42°C) and media compositions, as division defects often show condition-dependent severity. Fifth, timing controls using synchronized cultures help distinguish primary from secondary effects by revealing the exact stage of division affected by YciB disruption. Sixth, for localization studies, membrane protein controls with known localization patterns (both division-related and unrelated) confirm the specificity of YciB's septal positioning. Finally, when using fluorescent protein fusions, researchers should verify that the fusion itself doesn't disrupt function through complementation assays with the tagged construct .

What technological advances will enhance YciB functional characterization?

Technological advances poised to enhance YciB functional characterization span multiple methodological domains. Cryo-electron microscopy techniques optimized for membrane proteins will reveal YciB's detailed 3D structure and conformational states, advancing beyond the current understanding of basic membrane topology. Single-molecule tracking microscopy will allow researchers to follow YciB dynamics during cell division in real-time, revealing temporal relationships with ZipA and other division proteins. CRISPR interference (CRISPRi) systems permit precise control of YciB expression levels, enabling the study of dosage-dependent effects on cell morphology without complete gene deletion or overexpression artifacts. Advanced bacterial two-hybrid systems with split fluorescent proteins will provide spatial information about YciB interactions in addition to binary interaction data. Microfluidic growth chambers coupled with high-resolution time-lapse microscopy will allow tracking of individual cells through division cycles under controlled environmental conditions, revealing YciB's role in division timing and morphological transitions. Proximity-dependent biotin identification (BioID) adapted for bacterial systems will map YciB's protein interaction network more comprehensively than current methods. Finally, molecular dynamics simulations incorporating bacterial membrane compositions will predict how YciB's transmembrane domains influence membrane properties and protein-protein interactions, generating testable hypotheses about structure-function relationships .

What aspects of YciB function remain poorly understood?

Despite significant progress, several critical aspects of YciB function remain poorly understood. First, the precise biochemical activity of YciB remains uncharacterized—whether it functions as a structural protein, an enzyme, a transporter, or a signaling molecule is still unclear. Second, the complete protein interaction network of YciB beyond ZipA has not been comprehensively mapped, leaving gaps in our understanding of how it integrates into the broader cell division and elongation machinery. Third, the regulation of yciB expression throughout the cell cycle and in response to environmental stressors remains largely unexplored. Fourth, the evolutionary conservation and potential specialized functions of YciB homologs in other bacterial species have not been systematically investigated. Fifth, the molecular mechanism by which YciB influences ZipA localization at the septum is not fully elucidated, including whether this effect is direct or mediated through other proteins. Sixth, while YciB is known to affect cell morphology, its specific contribution to peptidoglycan synthesis pathways remains ambiguous, particularly how it might coordinate envelope growth with divisome assembly. Finally, the potential role of YciB in stress responses beyond osmotic challenge, such as antibiotic tolerance or membrane integrity maintenance under various environmental pressures, represents a significant knowledge gap that warrants further investigation .

How might YciB research inform broader understanding of bacterial cell division?

YciB research has significant potential to inform our broader understanding of bacterial cell division through several mechanisms. As a membrane protein that interacts with the essential division protein ZipA, YciB may represent a previously underappreciated regulatory node in divisome assembly, potentially revealing new layers of control in the division process. The discovery that YciB functions in a PBP3-independent manner suggests the existence of alternative pathways for coordinating membrane and cell wall synthesis during division, challenging the current paradigm that emphasizes PBP3's central role. YciB's involvement in both cell elongation and division processes provides a unique opportunity to study how bacteria balance these two fundamental aspects of growth. The phenotypic effects of YciB manipulation (shorter cells with deletion, elongated cells with overexpression) mirror division defects seen in other systems, suggesting that YciB might be part of a conserved mechanism for coupling division to cell size. Additionally, understanding how YciB influences membrane properties during division could provide insights into the physical forces that drive bacterial cytokinesis. From an evolutionary perspective, comparative studies of YciB across diverse bacterial species might reveal how division mechanisms have been adapted for different cellular morphologies and environmental niches. Ultimately, a comprehensive understanding of YciB could identify new targets for antimicrobial development, particularly compounds that disrupt division without targeting the well-studied FtsZ-based machinery .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.