Recombinant Escherichia coli O7:K1 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O7:K1 Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant E. coli O7:K1 Lgt refers to genetically engineered versions of the Lgt enzyme from E. coli serotype O7:K1, a pathogenic strain associated with meningitis and extraintestinal infections. The Lgt enzyme catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to prolipoproteins, a critical step in bacterial membrane biogenesis. Recombinant production enables detailed biochemical and structural studies, as well as therapeutic targeting, given its essential role in bacterial viability .

Enzyme Architecture

Lgt is an inner membrane protein with seven transmembrane segments. Its N-terminus faces the periplasm, while the C-terminus faces the cytoplasm . Key functional residues include:

  • Y26, N146, G154: Absolutely essential for catalysis.

  • R143, E151, R239, E243: Critical for enzymatic activity but not entirely indispensable .

ResiduePositionRole in Catalysis
Y26Periplasmic loopSubstrate binding
N146Membrane domainConformational stability
G154Membrane domainStructural integrity

Catalytic Mechanism

Lgt transfers a diacylglyceryl group to prolipoproteins, enabling their modification and maturation. This process is essential for lipoprotein stability and bacterial growth, as Lgt depletion leads to outer membrane permeabilization and cell death .

Serotype-Specific Context

E. coli O7:K1 strains are classified into two genomic groups:

  • Group 1 (B2 phylogroup): Carries invasion-related genes (e.g., ibeA) and utilizes the general secretory pathway.

  • Group 2 (D phylogroup): Employs type III secretion systems and shows host-specific pathogenicity .

Strain SerotypeVirulence FactorsGenomic GroupPathogenicity
O7:K1ibeA, neuCGroup 1Meningitis
O18:K1Lipoproteins, proteasesGroup 1Meningitis

Recombinant Production Challenges

While recombinant Lgt production in E. coli is feasible using T7 promoter systems (e.g., pET vectors), challenges include:

  • Toxicity: Overexpression may disrupt membrane integrity.

  • Post-Translational Modifications: Requires proper folding in heterologous hosts .

Role in Disease

Lgt is essential for E. coli survival. Inhibitors targeting Lgt (e.g., compounds G2823/G2824) disrupt lipoprotein biosynthesis, leading to:

  • Outer membrane permeabilization: Increased antibiotic sensitivity .

  • Attenuated virulence: Reduced serum resistance and in vivo pathogenicity .

Inhibitor Development

InhibitorTargetMechanismBactericidal Activity
G2823LgtCompetitive inhibitionE. coli: MIC ≤ 1 μM
G2824LgtAllosteric modulationA. baumannii: MIC ≤ 2 μM

Unanswered Questions

  • Serotype-Specific Lgt Variants: Limited data on O7:K1-specific Lgt mutations or structural adaptations.

  • Inhibitor Resistance: Potential resistance mechanisms in E. coli O7:K1 remain uncharacterized.

Prioritized Research Areas

  1. Structural Studies: Cryo-EM or X-ray crystallography of O7:K1 Lgt to identify serotype-specific binding pockets.

  2. Antibiotic Synergy: Combined use of Lgt inhibitors with β-lactams or aminoglycosides to exploit membrane permeability.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; ECIAI39_3247; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its function in bacterial cells?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme that catalyzes the first step in the biogenesis of bacterial lipoproteins in Gram-negative bacteria like Escherichia coli. Specifically, lgt transfers a diacylglyceryl group from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoprotein substrates, forming a thioether bond . This post-translational modification is crucial for the proper anchoring of lipoproteins to bacterial membranes.

The enzyme plays a vital role in bacterial physiology since lipoproteins are essential components that maintain the structural integrity of the bacterial outer membrane and contribute to various cellular functions including transport, adhesion, and pathogenesis . The lgt protein in E. coli O7:K1 consists of 291 amino acids and contains multiple transmembrane domains, reflecting its function within the bacterial membrane system .

Why is lgt considered a potential antibacterial target?

Lgt represents an attractive antibacterial target for several compelling reasons. First, depletion of lgt in clinical uropathogenic Escherichia coli strains leads to significant disruption of the outer membrane, resulting in increased permeability and heightened sensitivity to both serum killing and antibiotics . This membrane destabilization ultimately causes loss of bacterial viability.

Second, unlike other components of the lipoprotein biosynthesis pathway, targeting lgt appears to overcome a major resistance liability observed with other steps in the pathway. Specifically, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue bacterial growth after lgt depletion or inhibition . This represents a significant advantage over targeting other lipoprotein processing enzymes like LspA or LolCDE, where lpp deletion can mediate resistance.

Third, research has identified the first potent inhibitors of lgt that demonstrate bactericidal activity against wild-type Escherichia coli and Acinetobacter baumannii, validating lgt as a "druggable" antibacterial target . These findings collectively establish lgt as a promising target for novel antimicrobial development.

What is the primary enzymatic mechanism of lgt?

The enzymatic mechanism of lgt involves the transfer of a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the prolipoprotein substrate. This reaction releases glycerol phosphate as a byproduct. The specific steps include:

  • Binding of phosphatidylglycerol (substrate donor) and prolipoprotein (substrate acceptor) to lgt

  • Nucleophilic attack by the thiol group of the conserved cysteine in the lipobox motif of the prolipoprotein

  • Formation of a thioether bond between the diacylglyceryl group and the cysteine residue

  • Release of glycerol phosphate as a byproduct

In experimental biochemical assays, the enzymatic activity of lgt can be measured by detecting the release of glycerol phosphate. Since the phosphatidylglycerol substrate often contains a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) can be released during the reaction . Detection systems typically couple the released G3P to a luciferase reaction for quantification.

What are the established methods for studying lgt function in Escherichia coli?

Several complementary experimental approaches have been developed to study lgt function in E. coli:

Genetic Depletion Systems:
Researchers have engineered arabinose-inducible systems where lgt expression depends on arabinose supplementation. This allows controlled depletion of lgt by withdrawing arabinose from the growth medium . Such systems are particularly valuable for studying the essential nature of lgt and the consequences of its absence.

Biochemical Activity Assays:
In vitro enzymatic activity of lgt can be measured using a coupled assay system that detects the release of glycerol phosphate. This involves providing a peptide substrate (typically derived from the Pal lipoprotein) and phosphatidylglycerol, then measuring the G3P release using a luciferase-coupled reaction .

Western Blot Analysis of Lipoprotein Processing:
The processing state of lipoproteins, particularly Lpp (the major outer membrane lipoprotein), can be assessed by western blotting. Different forms of Lpp can be distinguished by their migration patterns on SDS-PAGE: unmodified pro-Lpp (UPLP), diacylglyceryl-modified pro-Lpp (DGPLP), and mature triacylated Lpp .

SDS Fractionation:
This technique separates SDS-insoluble peptidoglycan-associated proteins (PAP) from SDS-soluble non-PAP proteins, allowing the assessment of Lpp linkage to peptidoglycan .

Membrane Permeability Assays:
The functional consequences of lgt depletion or inhibition can be measured through increased membrane permeability to normally excluded compounds such as antibiotics or serum components .

How can recombinant lgt be expressed and purified for in vitro studies?

For biochemical and structural studies, recombinant lgt can be expressed and purified using the following methodology:

Expression System Selection:
E. coli expression systems are commonly used for recombinant lgt production. The full-length lgt gene (291 amino acids for E. coli O7:K1) can be cloned into expression vectors under the control of inducible promoters such as IPTG-inducible promoters .

Protein Extraction and Purification:
As a membrane protein, lgt requires detergent solubilization for extraction from the membrane fraction. Purification typically involves affinity chromatography using tags such as His-tag, followed by size exclusion chromatography to obtain pure protein .

Storage Conditions:
Purified recombinant lgt is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage periods . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

The recombinant protein can be used for various applications including enzyme activity assays, inhibitor screening, structural studies, and as an antigen for antibody production .

What are the specific effects of lgt inhibition on bacterial membrane structure and function?

Lgt inhibition has profound effects on bacterial membrane integrity and function, with cascading consequences for bacterial viability:

Outer Membrane Permeabilization:
Inhibition of lgt leads to significant permeabilization of the bacterial outer membrane, compromising its barrier function. This results in increased sensitivity to normally excluded compounds, including antibiotics and host defense factors .

Loss of Lipoprotein Anchoring:
Without proper diacylglyceryl modification, prolipoproteins cannot be correctly processed and anchored to the membrane. This disrupts the normal distribution and function of multiple lipoproteins that are critical for membrane structural integrity .

Peptidoglycan-Outer Membrane Linkage Disruption:
One of the most significant consequences of lgt inhibition is the disruption of peptidoglycan-outer membrane linkage mediated by Lpp (Braun's lipoprotein) and Pal lipoproteins. This weakens the cell envelope structure since these linkages are crucial for maintaining cell envelope stiffness and structural integrity .

Reduced Serum Resistance:
Lgt-depleted E. coli strains show markedly increased sensitivity to serum killing, indicating compromised defense against host immune factors . This has important implications for bacterial survival during infection.

Attenuated Virulence:
The structural and functional disruptions caused by lgt inhibition ultimately translate to attenuated virulence in in vivo infection models .

How does lgt inhibition compare with inhibition of other steps in the lipoprotein biosynthesis pathway?

Lgt inhibition differs distinctly from inhibition of other steps in the lipoprotein biosynthesis pathway in several important ways:

ParameterLgt InhibitionLspA InhibitionLolCDE Inhibition
Step targetedFirst step: diacylglyceryl transferSecond step: signal peptide cleavageTransport of lipoproteins to outer membrane
Effect on LppAccumulation of unmodified pro-Lpp (UPLP)Accumulation of diacylglyceryl modified pro-Lpp (DGPLP)No change in Lpp processing
Rescue by lpp deletionNot rescued by lpp deletionRescued by lpp deletionRescued by lpp deletion
PG-linkageSignificant reduction in PG-linked LppAccumulation of PG-linked Lpp formsNo effect on PG-linkage
Resistance mechanismsLower potential for resistance developmentVulnerable to lpp deletion-based resistanceVulnerable to lpp deletion-based resistance

The critical distinction is that while deletion of lpp provides resistance to inhibitors targeting LspA and LolCDE, it actually sensitizes cells to lgt inhibition . This represents a significant advantage for lgt as a therapeutic target, as it may be less susceptible to this common resistance mechanism.

What biochemical assays can be used to measure lgt enzymatic activity and inhibition?

Several sophisticated biochemical assays have been developed to measure lgt enzymatic activity and evaluate potential inhibitors:

Glycerol Phosphate Release Assay:
This assay measures the release of glycerol phosphate, which is a byproduct of the lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. The detection system typically couples the released glycerol-3-phosphate to a luciferase reaction for quantification through luminescence measurement .

Typical assay components include:

  • Purified recombinant lgt enzyme

  • Phosphatidylglycerol substrate (containing a racemic glycerol moiety)

  • Peptide substrate (derived from Pal lipoprotein, e.g., Pal-IAAC where C is the conserved cysteine)

  • Detection system for G3P (coupled luciferase reaction)

  • Potential inhibitors at varying concentrations

Peptide Substrate Specificity Controls:
Mutant peptide substrates with the conserved cysteine mutated to alanine (e.g., Pal-IAAA) serve as negative controls, as they cannot accept the diacylglyceryl modification .

IC50 Determination:
Potent inhibitors can be characterized by determining their IC50 values. For example, the lgt inhibitors G9066, G2823, and G2824 demonstrated IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively, in biochemical assays .

Cellular Validation Assays:
Complementary cellular assays can validate the on-target activity of potential inhibitors by examining the accumulation of Lpp intermediates through Western blot analysis .

What strategies can be used to determine if inhibitors specifically target lgt in bacterial cells?

Confirming the specificity of lgt inhibitors in bacterial cells requires multiple lines of evidence:

Accumulation of Lpp Intermediates:
Western blot analysis can detect the accumulation of characteristic Lpp forms. Specific inhibition of lgt should lead to the accumulation of unmodified pro-Lpp (UPLP), which can be distinguished from the intermediates that accumulate when other enzymes in the pathway are inhibited .

Phenotype Comparison with Genetic Depletion:
Multiple effects and phenotypes detected in cells treated with potential lgt inhibitors should recapitulate those observed in lgt inducible deletion strains. This concordance strongly argues against off-target effects as the main cause of bacterial death .

SDS Fractionation Analysis:
This technique separates SDS-insoluble peptidoglycan-associated proteins (PAP) from SDS-soluble non-PAP proteins. Analysis of Lpp forms in these fractions after inhibitor treatment can provide evidence of lgt inhibition .

Lpp C21A Mutant Studies:
Cells expressing Lpp with a C21A mutation (preventing diacylglyceryl modification) can be used to demonstrate that efficient peptidoglycan linkage requires prior diacylglyceryl modification by lgt .

Overexpression Studies:
Testing whether overexpression of lgt can confer resistance to putative inhibitors can provide evidence for target specificity, although the results may be complicated if inhibitors bind to highly conserved sites essential for enzyme function .

What are the potential resistance mechanisms that might develop against lgt inhibitors?

Understanding potential resistance mechanisms is crucial for antimicrobial development. For lgt inhibitors:

Target Site Mutations:
Interestingly, researchers have been unable to raise on-target resistant mutants to lgt inhibitors . This may be because mutations that disrupt inhibitor binding might also compromise the essential function of lgt, leading to cell death. This hypothesis is consistent with observations for other inhibitors that target highly conserved active sites, such as globomycin (which targets LspA) .

Altered Expression of Target:
Theoretically, bacteria might develop resistance through altered expression of lgt, but the essential nature of the enzyme limits this avenue since both too little and too much of the enzyme would be detrimental to bacterial survival.

Bypass Mechanisms:
Unlike with other lipoprotein processing inhibitors where lpp deletion provides resistance, lpp deletion actually sensitizes cells to lgt inhibition . This suggests that common bypass mechanisms may not be effective against lgt inhibitors.

Efflux Pump Overexpression:
While not specific to lgt, general resistance mechanisms such as efflux pump overexpression could potentially reduce the effectiveness of lgt inhibitors by lowering intracellular concentrations.

What structural insights would facilitate improved lgt inhibitor design?

Further structural insights would significantly advance lgt inhibitor development:

Active Site Architecture:
Detailed understanding of how lgt binds its phosphatidylglycerol and prolipoprotein substrates would be invaluable for structure-based drug design. Determining whether identified inhibitors competitively inhibit binding of either substrate would provide mechanistic insights crucial for optimizing inhibitor potency and specificity .

Transmembrane Domain Characterization:
Lgt contains multiple transmembrane domains that are critical for its function within the bacterial membrane . Structural characterization of these domains and their arrangement would facilitate the design of inhibitors that can effectively access and bind the enzyme within its native membrane environment.

Comparative Structural Analysis:
Comparing lgt structures across different bacterial species could identify both conserved features for broad-spectrum inhibitor design and species-specific features that might be exploited for selective targeting of particular pathogens.

What are the optimal conditions for working with recombinant lgt in laboratory settings?

Working effectively with recombinant lgt requires attention to several practical considerations:

Storage Conditions:
Recombinant lgt should be stored in Tris-based buffer with 50% glycerol at -20°C for regular storage or -80°C for extended storage periods . For working experiments, aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided as it may compromise protein activity .

Protein Stability:
As a membrane protein, lgt typically requires detergent or lipid environments to maintain proper folding and activity. The specific detergent requirements should be determined empirically for each experimental application.

Enzymatic Assay Conditions:
For enzymatic assays, the reaction conditions, including pH, temperature, and ionic strength, should be optimized. The assay typically includes phosphatidylglycerol substrate and a peptide substrate containing the conserved cysteine residue of the lipobox motif .

Expression System Selection:
For producing recombinant lgt, E. coli expression systems under the control of inducible promoters have proven effective . The complete coding sequence (1-291 amino acids for E. coli O7:K1 lgt) should be used for functional studies .

By addressing these practical considerations, researchers can effectively work with recombinant lgt to advance understanding of its structure, function, and potential as an antibacterial target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.