Recombinant Escherichia coli O7:K1 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB; ECIAI39_0600; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWTLLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the CrcB homolog relate to other bacterial fluoride transporters?

The CrcB homolog in E. coli O7:K1 belongs to a highly conserved family of fluoride transporters found across many bacterial species. Recent research indicates that CrcB proteins confer fluoride resistance by exporting fluoride ions from the cytoplasm, protecting cellular components from fluoride toxicity .

Research on fluoride transporters has identified two primary families: CrcB proteins and CLC-F antiporters, which resemble chloride transporters . The CrcB protein in E. coli O7:K1 is 98% identical to that in Pseudomonas putida KT2440, suggesting conservation of this mechanism across various bacterial genera . Studies indicate that deletion of crcB genes significantly increases bacterial sensitivity to fluoride, highlighting their physiological importance .

How should researchers design mutagenesis experiments for CrcB homolog studies?

When conducting mutagenesis experiments with the CrcB homolog, transposon mutagenesis has proven effective. Based on previously successful approaches, researchers should consider:

  • Using transposon systems such as Tn3HoHo1, which carries a promoterless lac operon to generate lacZ transcriptional fusions with target DNA sequences .

  • Examining mutated plasmids for their ability to react with specific antisera (e.g., O7 antiserum for O7-LPS expression studies) .

  • Investigating LPS pattern profiles of insertion mutants through electrophoresis of cell envelope fractions, followed by silver staining and immunoblotting analysis .

  • Analyzing β-galactosidase production by cells carrying plasmids with transposon insertions to determine transcription direction and regulation .

This approach has successfully identified phenotypic classes of mutants and defined essential regions for protein expression. For CrcB specifically, targeted mutagenesis of conserved regions could help identify critical residues involved in fluoride transport functionality.

What are the optimal conditions for recombinant expression of E. coli O7:K1 CrcB homolog?

For optimal recombinant expression of E. coli O7:K1 CrcB homolog, the following protocol has been successful:

  • Expression System: Express in E. coli BL21(DE3) using a pASK vector with C-terminal hexahistidine tag .

  • Induction Conditions: Induce at OD600 0.5 with 0.2 mg/mL anhydrotetracycline for 16 hours at 25°C .

  • Purification Method: Purify from clarified cell lysates using cobalt affinity resin (1mL/L culture) .

  • Buffer Systems:

    • Wash buffer: 100 mM NaCl, 20 mM imidazole, 20 mM Tris-HCl pH 8.0

    • Elution buffer: 400 mM imidazole

    • Final buffer: 100 mM NaCl, 20 mM HEPES pH 7.5 with 10% glycerol

  • Storage Conditions: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use. Avoid repeated freeze-thaw cycles .

What storage buffer composition is recommended for maintaining CrcB homolog stability?

The recommended storage buffer for maintaining CrcB homolog stability is a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For long-term storage, the following protocol is advised:

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) .

  • Aliquot to minimize freeze-thaw cycles and store at -20°C or -80°C for extended periods .

  • For short-term use, working aliquots can be stored at 4°C for up to one week .

Research indicates that repeated freezing and thawing significantly reduces protein stability and should be avoided. For experimental protocols requiring active protein, freshly thawed aliquots yield the most consistent results.

How can researchers assess the fluoride transport function of the CrcB homolog?

To assess the fluoride transport function of the CrcB homolog, several complementary approaches are recommended:

  • Fluoride Sensitivity Assays: Compare growth of strains with and without functional CrcB in media containing various concentrations of NaF. Research has shown that CrcB deletion makes bacteria significantly more sensitive to fluoride .

  • Protein Activity Assays: For purified CrcB, assess oligomerization in the presence of fluoride using:

    • Chemical crosslinking with glutaraldehyde followed by SDS-PAGE analysis

    • Dynamic light scattering (DLS) to measure hydrodynamic radius of protein particles in solution

  • Live Cell Imaging: Express fluorescently tagged CrcB and measure changes in fluorescence intensity upon exposure to fluoride. Single-cell imaging can detect significant reductions in fluorescence after 30 minutes with 0.3 mM NaF .

  • Functional Complementation: Transform CrcB-deficient strains with plasmids expressing wild-type or mutant CrcB and assess restoration of fluoride resistance. This approach can identify critical residues required for function .

What cellular phenotypes are associated with CrcB homolog dysfunction?

Research has identified several cellular phenotypes associated with CrcB homolog dysfunction:

  • Increased Fluoride Sensitivity: Strains lacking functional CrcB show significantly higher sensitivity to fluoride, with growth inhibition at concentrations that wild-type strains tolerate .

  • Cell Morphology Changes: Fluoride exposure in CrcB-deficient bacteria leads to cell shortening, a stress response not previously associated with fluoride but observed under starvation conditions in other species like Pseudomonas syringae .

  • Autolysis: In Streptococcus mutans, fluoride triggers stress responses including upregulation of competence-associated cell wall hydrolases. Without functional CrcB, this leads to an imbalance between immunity peptides and bacteriocins, resulting in autolysis .

  • Gene Expression Changes: Transcriptome analysis shows that CrcB-deficient strains exposed to fluoride exhibit altered expression of genes involved in stress response. This includes upregulation of the 6S RNA, which mediates switches between primary and alternative sigma factors during stress .

What NIH guidelines apply to research involving recombinant E. coli O7:K1 CrcB homolog?

Research involving recombinant E. coli O7:K1 CrcB homolog must comply with NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Key requirements include:

  • Institutional Biosafety Committee (IBC) Review and Approval: Experiments involving recombinant DNA require IBC approval before initiation .

  • Experiment Classification: Depending on the specific experimental design, work with recombinant CrcB may fall under different classification sections:

    • Section III-D: Experiments requiring IBC approval before initiation

    • Section III-E: Experiments requiring IBC notification simultaneous with initiation

  • Documentation Requirements: Principal Investigators must:

    • Report any new information bearing on the NIH Guidelines to the IBC within 30 days

    • Be adequately trained in good microbiological techniques

    • Adhere to IBC-approved emergency plans for handling accidental spills and personnel contamination

  • Compliance Scope: It's important to note that even if only one research project involving recombinant or synthetic nucleic acid molecules at an institution benefits from NIH support, all such projects must comply with these guidelines .

What biosafety level is appropriate for work with recombinant E. coli O7:K1 CrcB homolog?

Work with recombinant E. coli O7:K1 CrcB homolog typically requires Biosafety Level 2 (BSL-2) containment due to:

  • The pathogenic potential of the O7:K1 strain, which is associated with extraintestinal pathogenic E. coli (ExPEC) .

  • The recombinant nature of the experiments, which fall under NIH Guidelines Section III-D requiring IBC approval before initiation .

  • The potential transfer of drug resistance traits, which may require special containment considerations. Examples of experiments requiring heightened scrutiny include "transferring a drug resistance trait that is used, had previously been used, may be used (outside the U.S.), or that is related to other drugs that are used to treat or control disease agents" .

Researchers should consult with their institutional IBC for specific containment requirements based on their experimental design. For large-scale work (>10 liters of culture combined), additional approval requirements may apply .

How does the E. coli O7:K1 CrcB homolog relate to lipopolysaccharide biosynthesis?

The relationship between E. coli O7:K1 CrcB homolog and lipopolysaccharide (LPS) biosynthesis involves complex genetic and molecular interactions:

  • O7-LPS Region: Research has identified a region of approximately 14-17 kilobase pairs essential for O7-LPS expression . This region encodes at least 16 polypeptides with molecular masses ranging from 20 to 48 kilodaltons .

  • Transcriptional Control: Analysis of β-galactosidase production by cells carrying plasmids with transposon insertions indicated that transcription occurs in only one direction along the O7-LPS region . This directional control may influence CrcB expression when located within this genetic context.

  • Complementation Studies: O7-LPS-deficient mutants of strain VW187 were successfully complemented with cosmids pJHCV31 and pJHCV32, confirming these cosmids contain genetic information essential for O7 polysaccharide expression . The relationship between CrcB and these complementation regions provides insights into potential regulatory networks.

  • Phenotypic Classes: Experimental analysis identified three distinct phenotypic classes of mutants affecting O7-LPS expression , suggesting a multilayered regulatory mechanism that may interact with CrcB function under different environmental conditions.

What statistical approaches are appropriate for analyzing experimental data involving CrcB homolog function?

When analyzing experimental data related to CrcB homolog function, several statistical approaches should be considered to address the non-Gaussian distribution patterns typically observed in microbiological data:

  • Generalized Linear Mixed Models (GLMM): For reaction time (RT) data, GLMMs provide a solution to normality assumption problems without requiring data transformation. Consider using:

    • Gamma or Inverse Gaussian distribution assumptions rather than Gaussian

    • Identity link function (RT = ) or inverse link function (RT = −1000/) depending on data characteristics

  • Model Selection Criteria:

    • Evaluate Akaike Information Criterion (AIC) and Bayesian Information Criterion (BIC) to identify the best-fitting model

    • Compare residual patterns against predicted values to assess heteroscedasticity

    • Consider distributional fit to observed data density

  • Non-parametric Approaches: For microbial taxa abundance differences, use:

    • Generalized fold change measures rather than standard fold change

    • Blocked univariate Wilcoxon tests to assess differential abundance while accounting for study as a nuisance effect

    • Log-ratio transformation to address the compositional nature of microbial relative abundance data

  • Cross-validation Methods: To ensure model generalizability across experimental conditions:

    • Implement leave-one-study-out (LOSO) validation

    • Evaluate Area Under the Receiver Operating Characteristics curve (AUROC)

    • Assess false-positive rates on various datasets to ensure specificity

How can homology detection tools be applied to identify distant CrcB relatives in other organisms?

Recent advances in homology detection tools offer promising approaches for identifying distant CrcB relatives across diverse organisms:

  • SHARK-dive Approach: This method enables sensitive detection of evolutionary homologs even with low sequence identity. Unlike traditional BLAST or HMMER approaches that may miss distant homologs, SHARK-dive can detect functional homologies by analyzing:

    • Individual k-mer scores that highlight shared homology

    • Amino acid composition similarities, particularly regarding charged residues

    • Similar molecular/biochemical properties that may confer functional equivalence

  • Implementation Strategy:

    • Use the CrcB sequence as a query to search for potential homologs

    • Examine k-mer patterns (especially with k=5) that may be swapped in order between sequences

    • Look for similar amino acid compositions even when sequence identity is low

    • Evaluate predicted IDRs (intrinsically disordered regions) that may share functional properties

  • Validation Approach: Confirm predicted homologs through functional complementation experiments where the candidate gene is expressed in a CrcB-deficient strain to assess restoration of fluoride resistance .

How does the CrcB homolog contribute to virulence and host adaptation in pathogenic E. coli?

The CrcB homolog may contribute to virulence and host adaptation in pathogenic E. coli through several mechanisms:

  • Environmental Adaptation: Transcriptome analysis of E. coli O157:H7 under anaerobic conditions (similar to the ruminant gastrointestinal tract) revealed differential expression of several genes potentially related to CrcB function. This includes upregulation of genes associated with:

    • Curli pili (csgBA and csgDEFG)

    • Adherence (ompA, tdcA, and cadA)

    • Heat shock response (dnaK, dnaJ, groEL, and groES)

    • Stress regulation (rpoS encoding σ38)

  • Protozoan Interactions: When E. coli resides within environmental hosts such as free-living protozoa (Acanthamoeba castellanii), significant transcriptome changes occur, including:

    • Upregulation of 655 genes, including 40 involved in virulence

    • Induction of SOS response genes (lexA, recA)

    • Expression of genes involved in antibiotic resistance (rarD, macAB, marABR, mdtK, yojI, yhgN)

    • Activation of quorum sensing operon lsrACDB and iron acquisition systems

  • O-Island Encoded Genes: Differential expression of genes located in E. coli O157:H7 virulence-related O-islands suggests these regions play a role in host adaptation . The potential interaction between CrcB and these virulence factors represents an important area for future research.

  • Fluoride Resistance Mechanism: The natural fluoride resistance conferred by CrcB may provide a survival advantage in certain host environments, particularly in the oral cavity where fluoride concentrations may be elevated due to dental hygiene products .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.